Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00314
- pan locus tag?: SAUPAN001868000
- symbol: SAOUHSC_00314
- pan gene symbol?: mepR
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00314
- symbol: SAOUHSC_00314
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 328838..329257
- length: 420
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919541 NCBI
- RefSeq: YP_498904 NCBI
- BioCyc: G1I0R-291 BioCyc
- MicrobesOnline: 1288798 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
GTCGATGCACAAGATACGAGAAGAAAGAATATAGGGCTGACTACCTCTGGGATTAAACTC
GTAGAAGCATTCACTTCGATATTTGATGAAATGGAACAAACACTCGTATCGCAGTTATCT
GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00314
- symbol: SAOUHSC_00314
- description: hypothetical protein
- length: 139
- theoretical pI: 6.26722
- theoretical MW: 16172.2
- GRAVY: -0.669784
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)and 5 moremobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
- TheSEED :
- Transcriptional regulator, MarR family
- PFAM: HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 47.5)and 25 moreMarR; MarR family (PF01047; HMM-score: 37.6)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 29.7)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 21.9)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 21.6)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.8)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 19.4)HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 19.3)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.2)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.1)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.1)DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15)Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.7)no clan defined DUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 14.7)HTH (CL0123) Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.3)DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 13.5)AAA_lid (CL0671) Vps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 13.5)HTH (CL0123) HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.5)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 13.1)no clan defined DUF6664; Family of unknown function (DUF6664) (PF20369; HMM-score: 13)HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.4)HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors: Bis-indoles; Distamycin
- genes regulated by MepR*, TF important in Multidrug resistanceRegPrecise
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9936
- Cytoplasmic Membrane Score: 0.0038
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0022
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005476
- TAT(Tat/SPI): 0.000487
- LIPO(Sec/SPII): 0.000763
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: MepR* (repression) regulon
MepR* (TF) important in Multidrug resistance; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
