⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00390
- pan locus tag?: SAUPAN002110000
- symbol: SAOUHSC_00390
- pan gene symbol?: ssl5
- synonym:
- product: superantigen-like protein 5
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00390
- symbol: SAOUHSC_00390
- product: superantigen-like protein 5
- replicon: chromosome
- strand: +
- coordinates: 392971..393675
- length: 705
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919125 NCBI
- RefSeq: YP_498976 NCBI
- BioCyc: G1I0R-362 BioCyc
- MicrobesOnline: 1288870 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGAAAATGACAGCAATTGCGAAAGCAAGTTTAGCATTAGGTATTTTAGCAACAGGAACA
ATAACGTCATTGCATCAAACTGTAAATGCGAGTGAACATAAAGCAAAATATGAAAATGTG
ACAAAAGATATCTTTGACTTAAGAGATTACTATAGTGGCGCAAGTAAGGAACTTAAAAAT
GTTACTGGTTATCGTTATAGCAAAGGTGGCAAGCATTACCTTATCTTTGATAAAAATAGA
AAATTCACAAGAGTACAGATATTTGGTAAAGATATTGAAAGATTTAAAGCACGTAAAAAT
CCGGGATTAGACATATTTGTTGTTAAAGAAGCGGAAAACCGTAATGGCACAGTGTTTTCA
TATGGTGGTGTCACTAAGAAAAATCAAGACGCTTATTATGATTATATAAACGCACCAAGA
TTTCAAATCAAGAGAGATGAAGGTGACGGTATTGCTACGTACGGTAGAGTACACTACATT
TATAAAGAAGAGATTTCACTTAAAGAACTCGACTTTAAATTGAGACAGTATTTAATTCAA
AATTTTGATCTGTATAAAAAGTTTCCTAAAGATAGTAAGATAAAAGTGATAATGAAAGAT
GGCGGCTATTATACGTTTGAACTTAATAAAAAATTACAAACAAATCGCATGAGTGACGTC
ATTGACGGTAGAAATATTGAAAAAATAGAAGCCAACATTAGATAA60
120
180
240
300
360
420
480
540
600
660
705
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00390
- symbol: SAOUHSC_00390
- description: superantigen-like protein 5
- length: 234
- theoretical pI: 10.1246
- theoretical MW: 27169.9
- GRAVY: -0.679487
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Exotoxin 10
- PFAM: OB_enterotoxin (CL0658) SSL_OB; Staphylococcal superantigen-like OB-fold domain (PF09199; HMM-score: 106.6)Ubiquitin (CL0072) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 91.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 10
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.0264
- Extracellular Score: 0.9723
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: 5
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide SP(Sec/SPI) length 30 aa
- SP(Sec/SPI): 0.987323
- TAT(Tat/SPI): 0.008639
- LIPO(Sec/SPII): 0.002114
- Cleavage Site: CS pos: 30-31. VNA-SE. Pr: 0.9733
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKMTAIAKASLALGILATGTITSLHQTVNASEHKAKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKEEISLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Heather M Baker, Indira Basu, Matthew C Chung, Tom Caradoc-Davies, John D Fraser, Edward N Baker
Crystal structures of the staphylococcal toxin SSL5 in complex with sialyl Lewis X reveal a conserved binding site that shares common features with viral and bacterial sialic acid binding proteins.
J Mol Biol: 2007, 374(5);1298-308
[PubMed:17996251] [WorldCat.org] [DOI] (I p)Stefan Monecke, Peter Slickers, Ralf Ehricht
Assignment of Staphylococcus aureus isolates to clonal complexes based on microarray analysis and pattern recognition.
FEMS Immunol Med Microbiol: 2008, 53(2);237-51
[PubMed:18507678] [WorldCat.org] [DOI] (P p)Annemiek M E Walenkamp, Jovanka Bestebroer, Ingrid G J Boer, Roeline Kruizinga, Henk M Verheul, Jos A G van Strijp, Carla J C de Haas
Staphylococcal SSL5 binding to human leukemia cells inhibits cell adhesion to endothelial cells and platelets.
Cell Oncol: 2010, 32(1-2);1-10
[PubMed:20208131] [WorldCat.org] [DOI] (I p)Houyuan Hu, Paul C J Armstrong, Elie Khalil, Yung-Chih Chen, Andreas Straub, Min Li, Juliana Soosairajah, Christoph E Hagemeyer, Nicole Bassler, Dexing Huang, Ingo Ahrens, Guy Krippner, Elizabeth Gardiner, Karlheinz Peter
GPVI and GPIbα mediate staphylococcal superantigen-like protein 5 (SSL5) induced platelet activation and direct toward glycans as potential inhibitors.
PLoS One: 2011, 6(4);e19190
[PubMed:21552524] [WorldCat.org] [DOI] (I e)
