From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00497
  • pan locus tag?: SAUPAN002282000
  • symbol: SAOUHSC_00497
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00497
  • symbol: SAOUHSC_00497
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 498652..500034
  • length: 1383
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    TTGAAAAACACTTTATACCATCAACTTTATGAAAAATTAAAAAAACAAATAATTGAAGGT
    CAATTTAAAGAAGGCGATAAATTTTATTCTAAAAGACAATTAAGCAAACATTTATCTATT
    AGCCAAACAACCGTAGAGCATGCATATCAACTTCTATTAGACGAAGGTTACATTTATTCA
    AGACCTCGCTCTGGATATTTTGTGTCCGAAATTGAATCTTTAACAATTTTAAACAATCAA
    CCTATCCCCTCTCTTTTTGATGATGATTCATATAAACCAAAAGCGAGTGATGAAGCTTAT
    GATTATGCTTTTAATTTGGATGAAATAGATACGAAACATTTCCCTATAGAACTTTTCAGA
    AAGTATTCCAAAGATCTTTATGATACAAATCATTTAAATCAATTACGTAGAGGACATTTT
    CAAGGAGAATTACATTTGCGGTTTCAACTGGCATTTTATTTATTTACTAATCGTGGCGTA
    ATTTGTGATCCTAATCAAATTATAATTGGCTCATCTACCGAACAATTAGTAAATCAATTA
    GTCGATTTACTTTATACTTCAACATTTATTATCGAAAAACCTAGTTATCCACCAATCAAA
    AATATTTTAGATAAAAAACAAGTTGAATATGAACAAATTGAAGTTGAAGATAATGGAATA
    AACGTAGATGAAGTTATTAAATCACAAAAAAATATAGTATATATAACGCCTTCCCATCAA
    TTTCCAACTGGATATGTGATGGACTTAAAAAAACGAACTCAATTAATACAATGGGCTCAA
    GAAAAAGAAGAACGATTTATTATAGAAGATGATTATGATTCCGAGTTTAGATATTTCGGC
    AAACCCATTCCAGCAATTCAAGGTCTATATTCAAGAGGAGAAAAAGTGATTTATATCAGT
    ACATTTTCAAAGTCTATTTTTCCTAGCTGTCGAGTTGCATATATGGTGTTACCCTATTCT
    ATAATGAAAAAATATCATTCTCAAAATCACATTGAAGGCAACACTGTACCTGTTCATATG
    CAAAACCTTATTGCAACGTTTATATCTTCCGGTGGTTTTGAAAGGCATTTAAATAAAATG
    AGACGAATTTATCGTAGAAAACTAACCTATATTTTAAAAAGATTGAAACCTTACAAAGAG
    CAGCTTGATATTCAAGGTGCTGAAACGGGTATGCATTTTACAATTACAGTAAAAAATGGA
    TTAACATTACAAGAGTGTCTTGATAGAGCAAACAAAGTAAAGTTAAAATTACAAGTTTAT
    AATTTTGATGATGATCAAGACTATAAGAAAACCCCTAAATTTATATTAGGCTTTGGCGGT
    ATAGACGATGATGCTTTAAAACCGCATGTAGACGCTCTAATAAAATCATTAATTATAAAG
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1383

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00497
  • symbol: SAOUHSC_00497
  • description: hypothetical protein
  • length: 460
  • theoretical pI: 8.55168
  • theoretical MW: 53954.4
  • GRAVY: -0.510217

Function[edit | edit source]

  • TIGRFAM:
    enduracididine biosynthesis enzyme MppQ (TIGR04461; EC 2.-.-.-; HMM-score: 87.9)
    and 12 more
    succinyldiaminopimelate transaminase (TIGR03538; EC 2.6.1.17; HMM-score: 33.8)
    Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 32.5)
    Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 31.9)
    Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 29.9)
    Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 29.9)
    Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 24.4)
    Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 24.4)
    LL-diaminopimelate aminotransferase (TIGR03542; EC 2.6.1.83; HMM-score: 18.1)
    Signal transduction Regulatory functions DNA interactions biotin operon repressor (TIGR00122; HMM-score: 16.6)
    succinyldiaminopimelate transaminase (TIGR03539; EC 2.6.1.17; HMM-score: 16.1)
    beta-methylarginine biosynthesis bifunctional aminotransferase (TIGR04544; EC 2.6.-.-; HMM-score: 15.5)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 13.7)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, Pigments Lipoic acid BEY LIP  Predicted transcriptional regulator of pyridoxine metabolism
    and 2 more
    Pyridoxine Pyridoxin (Vitamin B6) Biosynthesis  Predicted transcriptional regulator of pyridoxine metabolism
    Test Pyridoxin B6  Predicted transcriptional regulator of pyridoxine metabolism
  • PFAM:
    PLP_aminotran (CL0061) Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 45.7)
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 43.8)
    and 6 more
    HTH_11; HTH domain (PF08279; HMM-score: 17.2)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16)
    NUMOD1; NUMOD1 domain (PF07453; HMM-score: 15.3)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 14.2)
    NADP_Rossmann (CL0063) MOLO1; Modulator of levamisole receptor-1 (PF17175; HMM-score: 12.5)
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 9.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: Pyridoxal-5-phosphate
  • genes regulated by PdxR, TF important in Pyridoxine biosynthesis [1]
    activation
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00453
    • TAT(Tat/SPI): 0.000382
    • LIPO(Sec/SPII): 0.000587
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTVEHAYQLLLDEGYIYSRPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAFNLDEIDTKHFPIELFRKYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICDPNQIIIGSSTEQLVNQLVDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINVDEVIKSQKNIVYITPSHQFPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGKPIPAIQGLYSRGEKVIYISTFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHMQNLIATFISSGGFERHLNKMRRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKNGLTLQECLDRANKVKLKLQVYNFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLIIK

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAOUHSC_00497 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]