Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00884
- pan locus tag?: SAUPAN003048000
- symbol: SAOUHSC_00884
- pan gene symbol?: mnhF
- synonym:
- product: monovalent cation/H+ antiporter subunit F
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00884
- symbol: SAOUHSC_00884
- product: monovalent cation/H+ antiporter subunit F
- replicon: chromosome
- strand: -
- coordinates: 848527..848820
- length: 294
- essential: no [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919231 NCBI
- RefSeq: YP_499437 NCBI
- BioCyc: G1I0R-827 BioCyc
- MicrobesOnline: 1289348 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATCATAATGTTATTATCGTTATTGCATTAATCATAGTTGTCATTTCTATGTTAGCT
ATGCTCATTCGCGTTGTGCTAGGCCCATCACTTGCCGATCGTGTTGTCGCATTAGATGCG
ATTGGTCTTCAATTAATGGCAGTTATAGCATTATTCAGTATTTTATTAAATATTAAATAC
ATGATTGTCGTTATTATGATGATTGGTATATTAGCTTTTTTAGGTACTGCAGTATTCTCT
AAATTTATGGACAAAGGTAAGGTGATTGAACATGATCAAAATCATACTGATTAG60
120
180
240
294
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00884
- symbol: SAOUHSC_00884
- description: monovalent cation/H+ antiporter subunit F
- length: 97
- theoretical pI: 7.7971
- theoretical MW: 10616.1
- GRAVY: 1.3701
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Plasmid functions entry exclusion protein TrbK (TIGR04361; HMM-score: 9.9)and 1 moreTIGR03943 family protein (TIGR03943; HMM-score: 6.5)
- TheSEED:
- PFAM: no clan defined MrpF_PhaF; Multiple resistance and pH regulation protein F (MrpF / PhaF) (PF04066; HMM-score: 49.9)and 2 moreABC-2 (CL0181) ABC2_membrane_5; ABC-2 family transporter protein (PF13346; HMM-score: 14.5)no clan defined Deltameth_res; Deltamethrin resistance (PF16020; HMM-score: 6.2)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.033588
- TAT(Tat/SPI): 0.000316
- LIPO(Sec/SPII): 0.021791
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNHNVIIVIALIIVVISMLAMLIRVVLGPSLADRVVALDAIGLQLMAVIALFSILLNIKYMIVVIMMIGILAFLGTAVFSKFMDKGKVIEHDQNHTD
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_00883 < SAOUHSC_00884 < SAOUHSC_00885 < SAOUHSC_00886 < SAOUHSC_00887 < SAOUHSC_00888 < SAOUHSC_00889 < SAOUHSC_00890
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]