From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00899
  • pan locus tag?: SAUPAN003068000
  • symbol: SAOUHSC_00899
  • pan gene symbol?: argG
  • synonym:
  • product: argininosuccinate synthase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00899
  • symbol: SAOUHSC_00899
  • product: argininosuccinate synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 863304..864509
  • length: 1206
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGAAAGAGAAAATTGTTTTAGCATATTCAGGAGGACTAGATACAAGTGTGGCCGTTCAA
    TGGCTTATCGACAAAGGATACGACGTTGTAGCTTGTTGCCTAGATGTTGGTGAAGGTAAA
    GATTTAGACATCGTTTATAAAAAAGCTTTAGATATGGGAGCAGTTGAATGTCATATTATT
    GATGCAACAAAAGAATTTAGTGATGAGTATGTAAGTTATGCAATCAAAGGAAATTTAATG
    TATGAAAATGCATATCCATTAGTTTCAGCTTTATCAAGACCATTAATCGCTAAAAAATTA
    GTAGAGATTGCTGAGAAAACAAATTCAGTAGGTATTGCACATGGTTGTACTGGTAAAGGG
    AATGACCAAGTACGTTTCGAAGTTGCCATTAAAGCATTAAACCCATCATTGAAAGCATTC
    GCACCTGTACGTGAGTGGGCATGGAGTCGTGAAGAAGAAATCGATTATGCAATTAAACAT
    AATATCCCTGTATCAATCAACCATGATTCACCTTATTCTATCGATCAAAATCTATGGGGC
    AGAGCGAATGAATGTGGTATTTTAGAAGATCCTTATGCTGCGCCACCAGAGGATGCGTTC
    GATCTAACAAATGCTTTAGAAGAAACACCAGATACTGCTGATGAAATCATTTTAACGTTT
    GATAAAGGCATCCCAGTTCAAATTGATGGCAAAACATATGAATTAGACGATTTAATTTTA
    ACGTTGAATGCATTAGCTGGTAAGCATGGTATCGGAAGAATTGACCATGTAGAAAATAGA
    CTTGTAGGTATCAAATCAAGAGAAATTTATGAGGCACCTGCTGCAGAAGTTATTTTAAAA
    GCGCATAAAGCATTAGAAACGATTACGTTAACGAAAGATGTCGCACACTTTAAACCAATC
    ATTGAGAAGCAATTTGCTGAACAACTATACAATGGACTTTGGTTCTCACCTTTAACTGAT
    AGCTTGAAATTATTTATTGATAGTACTCAGCAATACGTAAGTGGTGATGTCAGAATTAAA
    TTATTCAAAGGTAATGCCATCGTGAATGGTAGAAAATCACCTTACACATTATATGATGAA
    AAATTAGCAACTTATACAAAAGAAGATGCATTTAATCAAGACGCTGCTGTTGGCTTTATC
    GATATCTATGGTTTACCTACTCAAGTAAATGCGATGTTGCATGGAGGCTATAGCAATGAG
    CAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1206

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00899
  • symbol: SAOUHSC_00899
  • description: argininosuccinate synthase
  • length: 401
  • theoretical pI: 4.61504
  • theoretical MW: 44455.1
  • GRAVY: -0.182544

Function[edit | edit source]

  • reaction:
    EC 6.3.4.5?  ExPASy
    Argininosuccinate synthase ATP + L-citrulline + L-aspartate = AMP + diphosphate + N(omega)-(L-arginino)succinate
  • TIGRFAM:
    Metabolism Amino acid biosynthesis Glutamate family argininosuccinate synthase (TIGR00032; EC 6.3.4.5; HMM-score: 524.1)
    and 5 more
    Unknown function General queuosine biosynthesis protein QueC (TIGR00364; HMM-score: 14.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (TIGR00420; EC 2.1.1.61; HMM-score: 13.1)
    Hypothetical proteins Conserved TIGR00268 family protein (TIGR00268; HMM-score: 12.7)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA sulfurtransferase ThiI (TIGR00342; EC 2.8.1.4; HMM-score: 12.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine tRNA sulfurtransferase ThiI (TIGR00342; EC 2.8.1.4; HMM-score: 12.5)
  • TheSEED:  
    Amino Acids and Derivatives Arginine; urea cycle, polyamines Arginine Biosynthesis extended  Argininosuccinate synthase (EC 6.3.4.5)
    and 2 more
    Miscellaneous Miscellaneous - no subcategory EC 6.3.4.- Ligases that form carbon-nitrogen bonds  Argininosuccinate synthase (EC 6.3.4.5)
    Plant-Prokaryote comparative genomics Omega-amidase KE2  Argininosuccinate synthase (EC 6.3.4.5)
  • PFAM:
    HUP (CL0039) Arginosuc_synth; Arginosuccinate synthase (PF00764; HMM-score: 556.4)
    and 3 more
    tRNA_Me_trans; tRNA methyl transferase (PF03054; HMM-score: 16.9)
    QueC; Queuosine biosynthesis protein QueC (PF06508; HMM-score: 14.2)
    ThiI; Thiamine biosynthesis protein (ThiI) (PF02568; HMM-score: 11.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SAOUHSC_02494(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SAOUHSC_00530elongation factor Tu  [1] (data from MRSA252)
    SAOUHSC_01794glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.055477
    • TAT(Tat/SPI): 0.000643
    • LIPO(Sec/SPII): 0.011175
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKEKIVLAYSGGLDTSVAVQWLIDKGYDVVACCLDVGEGKDLDIVYKKALDMGAVECHIIDATKEFSDEYVSYAIKGNLMYENAYPLVSALSRPLIAKKLVEIAEKTNSVGIAHGCTGKGNDQVRFEVAIKALNPSLKAFAPVREWAWSREEEIDYAIKHNIPVSINHDSPYSIDQNLWGRANECGILEDPYAAPPEDAFDLTNALEETPDTADEIILTFDKGIPVQIDGKTYELDDLILTLNALAGKHGIGRIDHVENRLVGIKSREIYEAPAAEVILKAHKALETITLTKDVAHFKPIIEKQFAEQLYNGLWFSPLTDSLKLFIDSTQQYVSGDVRIKLFKGNAIVNGRKSPYTLYDEKLATYTKEDAFNQDAAVGFIDIYGLPTQVNAMLHGGYSNEQ

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: CodY* (repression) regulon, ArgR* (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise  
    ArgR(TF)important in Arginine biosynthesis, Arginine degradation; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]