From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01382
  • pan locus tag?: SAUPAN003789000
  • symbol: SAOUHSC_01382
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01382
  • symbol: SAOUHSC_01382
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1325278..1325622
  • length: 345
  • essential: no [1] DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACATTATTCGATATGCCTAATTATTTATGGATCACAACATTAATAATGATTTTATTA
    ACAATATTCTGTTGCTTAGTTTTAAATAAATGGTTTGTATCTGCAGTAATTACATTTGTT
    ATATTAGGTGTGCTTGCATTTTTTATTCCAAATTTTCAAGATATAAAATATCAACCATTA
    TTAGGATACGCTGCATTTTTAGCGATTATGAGTTTATTAATTAGTTTTCTATTATGGTAT
    TTTACTAGAAATTGGCGTAAAGAAAGAAAAGCGCGTAAATTAGAAAAGCAAATTGAAAAA
    TACGGCTATGAGGGCGCTGAACTTCGCCGTAAAGATAAAAAATAA
    60
    120
    180
    240
    300
    345


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01382
  • symbol: SAOUHSC_01382
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 10.156
  • theoretical MW: 13657.4
  • GRAVY: 0.431579

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis type VI secretion protein IcmF (TIGR03348; HMM-score: 14.7)
    and 3 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 11.4)
    Metabolism Transport and binding proteins Unknown substrate AspT/YidE/YbjL antiporter duplication domain (TIGR01625; HMM-score: 11)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 9.1)
  • TheSEED  :
    • FIG01107933: hypothetical protein
  • PFAM:
    no clan defined DUF6688; DUF6688 N-terminal domain (PF20394; HMM-score: 22.4)
    and 21 more
    GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 17.2)
    no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 15.6)
    SUa-2TM; SMODS- and Ubiquitin system-associated 2TM effector domain (PF18179; HMM-score: 15.6)
    TMEM238; TMEM238 protein family (PF15125; HMM-score: 14.8)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 14.4)
    LysE (CL0292) NicO; High-affinity nickel-transport protein (PF03824; HMM-score: 14)
    ThrE (CL0470) ThrE; Putative threonine/serine exporter (PF06738; HMM-score: 13.6)
    no clan defined DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 13.4)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 13.3)
    DUF3149; Protein of unknown function (DUF3149) (PF11346; HMM-score: 13.3)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 13.2)
    NADP_Rossmann (CL0063) CoA_binding_3; CoA-binding domain (PF13727; HMM-score: 12.2)
    no clan defined MENTAL; Cholesterol-capturing domain (PF10457; HMM-score: 10.3)
    TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 10)
    no clan defined DUF6199; Family of unknown function (DUF6199) (PF19701; HMM-score: 9.9)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 9.4)
    Marvel-like (CL0396) MARVEL; Membrane-associating domain (PF01284; HMM-score: 8.9)
    no clan defined E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 8.6)
    PhoR; Phosphate regulon sensor protein PhoR (PF11808; HMM-score: 7.1)
    SieB; Super-infection exclusion protein B (PF14163; HMM-score: 6.3)
    GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 5.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9997
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0003
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001183
    • TAT(Tat/SPI): 0.000187
    • LIPO(Sec/SPII): 0.145513
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPLLGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]