From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1215 [new locus tag: SA_RS06905 ]
  • pan locus tag?: SAUPAN003789000
  • symbol: SA1215
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1215 [new locus tag: SA_RS06905 ]
  • symbol: SA1215
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1387988..1388332
  • length: 345
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACATTATTCGATATGCCTAATTATTTATGGATCACAACATTAATAATGATTTTATTA
    ACAATATTCTGTTGCTTAGTTTTAAATAAATGGTTTGTATCTGCAGTAATTACATTTGTT
    ATATTAGGTGTGCTTGCATTTTTTATTCCAAATTTTCAAGATATAAAATATCAACCATTA
    TTAGGATACGCTGCATTTTTAGCGATTATGAGTTTATTAATTAGTTTTCTATTATGGTAT
    TTTACTAGAAATTGGCGTAAAGAAAGAAAAGCGCGTAAATTAGAAAAGCAAATTGAAAAA
    TACGGCTATGAGGGCGCTGAACTTCGCCGTAAAGATAAAAAATAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1215 [new locus tag: SA_RS06905 ]
  • symbol: SA1215
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 10.156
  • theoretical MW: 13657.4
  • GRAVY: 0.431579

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis type VI secretion protein IcmF (TIGR03348; HMM-score: 14.7)
    and 3 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 11.4)
    Metabolism Transport and binding proteins Unknown substrate AspT/YidE/YbjL antiporter duplication domain (TIGR01625; HMM-score: 11)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 9.1)
  • TheSEED  :
    • FIG01107933: hypothetical protein
  • PFAM:
    NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 20.8)
    and 22 more
    MviN_MATE (CL0222) Polysacc_synt; Polysaccharide biosynthesis protein (PF01943; HMM-score: 16.3)
    no clan defined TMEM238; TMEM238 protein family (PF15125; HMM-score: 15.7)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 14.3)
    APC (CL0062) K_trans; K+ potassium transporter (PF02705; HMM-score: 14.1)
    LysE (CL0292) NicO; High-affinity nickel-transport protein (PF03824; HMM-score: 13.6)
    no clan defined DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 13.4)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 13.3)
    MENTAL; Cholesterol-capturing domain (PF10457; HMM-score: 12.8)
    PRA1; PRA1 family protein (PF03208; HMM-score: 12.5)
    TNF_receptor (CL0607) stn_TNFRSF12A; Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain (PF12191; HMM-score: 12.3)
    no clan defined DUF3149; Protein of unknown function (DUF3149) (PF11346; HMM-score: 11)
    DUF4199; Protein of unknown function (DUF4199) (PF13858; HMM-score: 10.2)
    NADP_Rossmann (CL0063) CoA_binding_3; CoA-binding domain (PF13727; HMM-score: 9.6)
    no clan defined Tweety; Tweety (PF04906; HMM-score: 9)
    DUF3329; Domain of unknown function (DUF3329) (PF11808; HMM-score: 8.9)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 8.3)
    OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 8)
    E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 7.2)
    Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 7.1)
    SieB; Super-infection exclusion protein B (PF14163; HMM-score: 6.9)
    Vpu; Vpu protein (PF00558; HMM-score: 6.3)
    GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 5.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001183
    • TAT(Tat/SPI): 0.000187
    • LIPO(Sec/SPII): 0.145513
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPLLGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]