Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001367 [new locus tag: EGJ38_RS06825 ]
- pan locus tag?: SAUPAN003789000
- symbol: EGJ38_001367
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001367
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001367 [new locus tag: EGJ38_RS06825 ]
- symbol: EGJ38_001367
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1381085..1381429
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423331 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACATTATTCGATATGCCTAATTATTTATGGATCACAACATTAATAATGATTTTATTA
ACAATATTCTGTTGCTTAGTTTTAAATAAATGGTTTGTATCTGCGGTAATTACATTTGTT
ATATTAGGTGTGCTTGCATTTTTTATTCCAAATTTTCAAGATATAAAATATCAACCATTA
TTAGGATACGCTGCATTTTTAGCGATTATGAGTTTATTAATTAGTTTTCTATTATGGTAT
TTTACTAGAAATTGGCGTAAAGAAAGAAAAGCGCGTAAATTAGAAAAGCAAATTGAAAAA
TACGGCTATGAGGGCGCTGAACTTCGCCGTAAAGATAAAAAATAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001367 [new locus tag: EGJ38_RS06825 ]
- symbol: EGJ38_001367
- description: hypothetical protein
- length: 114
- theoretical pI: 10.156
- theoretical MW: 13657.4
- GRAVY: 0.431579
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type VI secretion protein IcmF (TIGR03348; HMM-score: 14.7)and 3 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 11.4)Transport and binding proteins Unknown substrate AspT/YidE/YbjL antiporter duplication domain (TIGR01625; HMM-score: 11)Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 9.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF6688; DUF6688 N-terminal domain (PF20394; HMM-score: 22.4)and 21 moreGPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 17.2)no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 15.6)SUa-2TM; SMODS- and Ubiquitin system-associated 2TM effector domain (PF18179; HMM-score: 15.6)TMEM238; TMEM238 protein family (PF15125; HMM-score: 14.8)DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 14.4)LysE (CL0292) NicO; High-affinity nickel-transport protein (PF03824; HMM-score: 14)ThrE (CL0470) ThrE; Putative threonine/serine exporter (PF06738; HMM-score: 13.6)no clan defined DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 13.4)LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 13.3)DUF3149; Protein of unknown function (DUF3149) (PF11346; HMM-score: 13.3)O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 13.2)NADP_Rossmann (CL0063) CoA_binding_3; CoA-binding domain (PF13727; HMM-score: 12.2)no clan defined MENTAL; Cholesterol-capturing domain (PF10457; HMM-score: 10.3)TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 10)no clan defined DUF6199; Family of unknown function (DUF6199) (PF19701; HMM-score: 9.9)Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 9.4)Marvel-like (CL0396) MARVEL; Membrane-associating domain (PF01284; HMM-score: 8.9)no clan defined E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 8.6)PhoR; Phosphate regulon sensor protein PhoR (PF11808; HMM-score: 7.1)SieB; Super-infection exclusion protein B (PF14163; HMM-score: 6.3)GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 5.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9997
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001183
- TAT(Tat/SPI): 0.000187
- LIPO(Sec/SPII): 0.145513
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423331 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPLLGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001366 < EGJ38_001367
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)