From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-MAR-2011 (discontinued in NCBI 03-AUG-2016)

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01554
  • pan locus tag?: SAUPAN001472000
  • symbol: SAOUHSC_01554
  • pan gene symbol?:
  • synonym:
  • product: PV83 orf 27-like protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01554
  • symbol: SAOUHSC_01554
  • product: PV83 orf 27-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1495120..1495428
  • length: 309
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACGTTCACCTTATCAGATGAACAATATAAAAATCTTTGTACTAACTCTAACAAGTTA
    TTAGATAAACTTCACAAAGCATTAAAAGATCGTGAAGAGTACAAGAAGCAACGAGATGAG
    CTTATTGGGGATATAGCGAAGTTACGAGATTGTAACAAAGAACTGGAGAAGAAAGCAAGC
    GCATGGGATAGGTATTGCAAGAGCGTTGAAAAAGATTTAATAAACGAATTCGGTAACGAT
    GATGAAAGAGTTAAATTCGGAATGGAATTAAACAATAAAATTTTTATGGAGGATGACACA
    AATGAATAA
    60
    120
    180
    240
    300
    309

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01554
  • symbol: SAOUHSC_01554
  • description: PV83 orf 27-like protein
  • length: 102
  • theoretical pI: 4.85853
  • theoretical MW: 12143.6
  • GRAVY: -1.16569

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein, SAB1734c homolog [SA bacteriophages 11, Mu50B]
  • PFAM:
    no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 17.7)
    Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 15)
    LOH1CR12; Tumour suppressor protein (PF10158; HMM-score: 14.6)
    and 4 more
    Spectrin (CL0743) Spectrin_Anc-1; Nuclear anchorage protein 1, spectrin-like repeat (PF24611; HMM-score: 14.1)
    Peptidase_MA (CL0126) Peptidase_M3; Peptidase family M3 (PF01432; HMM-score: 12.8)
    no clan defined MCU; Mitochondrial calcium uniporter (PF04678; HMM-score: 12.5)
    TPR (CL0020) Importin_rep_6; Importin repeat 6 (PF18829; HMM-score: 11.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8815
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0.0027
    • Extracellular Score: 0.1156
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005526
    • TAT(Tat/SPI): 0.000572
    • LIPO(Sec/SPII): 0.001264
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTFTLSDEQYKNLCTNSNKLLDKLHKALKDREEYKKQRDELIGDIAKLRDCNKELEKKASAWDRYCKSVEKDLINEFGNDDERVKFGMELNNKIFMEDDTNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]