From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01575
  • pan locus tag?: SAUPAN005125000
  • symbol: SAOUHSC_01575
  • pan gene symbol?:
  • synonym:
  • product: helix-turn-helix domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01575
  • symbol: SAOUHSC_01575
  • product: helix-turn-helix domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1503978..1504691
  • length: 714
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAACAAAGAAAGAAATATTATTATAGCCAAAAACATTAGAAAATTTCTCAACGATTCA
    AATATGTCTCAAAAGAAACTTGCTGAACTCATTAACATAAAACCATCTACTTTAAGCGAT
    TATTTAAATTTACGTTCCAACCCCTCTCACGGCGTTATACAAAGGATAGCTGATGTTTTC
    GAGGTTGGTAAAAGCGACATAGATACTACATACAAAGACGATAACGACATCACTTCCATA
    TACAACAAACTCACACCTCCCCGCCAAGAAAACGTACTTAACTATGCAAATGAACAATTG
    GAAGAACAGAATTCTAAAGGAGATAACGTTGTAGATATTAATTCATATAAACAGGAGAAA
    ACTCCAGTTAACGTCAATGGTTGCGTCTCTGCTGGTGTAGGAGAACGTTTACACGATGAA
    ACGCTATTTACTGAAATGGTTAAAGGACCTATCCCCACACACGATTTAGCGTTAAAAGTA
    AATGGTGATTCTATGGAACCTATGTTTAAAGATGGCGAAATCATATTTGTGGAGAAAACT
    CACAATATAAAGAATGGACAAATTGGTATATTCATCATTGAAGAAGAAGCGTACGTTAAG
    AAAGTCTTTGTTGAAGATGATAGATTGACTCTAGTTTCACTAAATAAAGATTACGACGAT
    CTACACTTTTATAGAAATGAAAGTGTGAGGTTAATTGGAAAAGTTATTTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01575
  • symbol: SAOUHSC_01575
  • description: helix-turn-helix domain-containing protein
  • length: 237
  • theoretical pI: 5.05491
  • theoretical MW: 27017.4
  • GRAVY: -0.528692

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 41.6)
    Signal transduction Regulatory functions DNA interactions repressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 41.6)
    and 9 more
    signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 26)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 24.4)
    Cellular processes Cellular processes Detoxification nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 16.7)
    Genetic information processing Protein fate Protein modification and repair nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 16.7)
    ParB/RepB/Spo0J family partition protein (TIGR00180; HMM-score: 15.9)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 15.3)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 15.3)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 15.3)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 12.5)
  • TheSEED  :
    • Phage repressor protein cI
  • PFAM:
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 91.7)
    and 17 more
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 42.2)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 36)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 25.5)
    HNF-1_N; Hepatocyte nuclear factor 1 (HNF-1), N terminus (PF04814; HMM-score: 21.4)
    Peptidase_SF (CL0299) Peptidase_S26; Signal peptidase, peptidase S26 (PF10502; HMM-score: 18.4)
    HTH (CL0123) HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 16.7)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.6)
    DUF7726; Domain of unknown function (DUF7726) (PF24852; HMM-score: 16)
    MXAN_049 (CL0767) Imm43; Immunity protein 43 (PF15570; HMM-score: 13.6)
    PELOTA (CL0101) TSNR_N; Thiostrepton-resistance methylase, N terminus (PF04705; HMM-score: 13.4)
    PDDEXK (CL0236) PDDEXK_10; PD-(D/E)XK nuclease superfamily (PF07788; HMM-score: 13)
    HTH (CL0123) HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 12.5)
    MarR; MarR family (PF01047; HMM-score: 12.3)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 12.2)
    PIN (CL0280) DUF5615; Domain of unknown function (DUF5615) (PF18480; HMM-score: 12.1)
    HTH (CL0123) Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 12)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 11.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9768
    • Cytoplasmic Membrane Score: 0.0012
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0218
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004779
    • TAT(Tat/SPI): 0.000511
    • LIPO(Sec/SPII): 0.000535
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVFEVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEKTPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKTHNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]