From AureoWiki
Jump to navigation Jump to search

⊟Summary[edit | edit source]

  • pan ID?: SAUPAN005125000
  • symbol?: —
  • synonym:
  • description?: XRE family transcriptional regulator

      descriptions from strain specific annotations:

    • XRE family transcriptional regulator
    • helix-turn-helix domain-containing protein
    • phage cI-like repressor
    • phi77 ORF011-like protein, phage transcriptional repressor
    • phage transcriptional regulator
    • CI-like repressor, phage associated
    • helix-turn-helix family protein
    • peptidase S24 S26A and S26B
    • phage repressor
    • Phage transcriptional repressor
    • putative phage repressor protein
    • repressor-like protein
    • transcription regulator
  • strand?: +
  • coordinates?: 5264707..5269215
  • synteny block?: BlockID0039780
  • occurrence?: in 58% of 33 strains

cI : prophage induction repressor cI

Staphylococcal prophage typically employ a lysogenic-lytic regulatory switch analogous to the cI-cro system in coliphage lambda. cI binding drives "leftward" transcription of lysogeny modules only. Some prophage separate cI's DNA-binding and proteolytic domains into two distinct proteins resulting in the truncated transcriptional repressor cI* and a separate cI*-specific endopeptidase. Strong evolutionary pressures drive diversity in cI-cro DNA operator sequences to allow independent regulation of prophages in the context of multiple integrated prophage. Known or suspected operator sequences are reproduced below:

Prophage Prototype Accession Number cI protein DNA-binding residues Crystal Structure cI Operator mor protein DNA binding residues Crystal Structure mor Operator  cI-mor heterodimer  References
φ11 AF424781 AAL82233.1         Q25, D26, A37, S40, T44, G45 TTTRC-n5-GTRTA AAL82234.1         Q16, E17, E28, R31, L35, G36 TACACG-n3-CGTGTA No [1]
φ12 AF424782 AAL82286.1 — ATAYGAAA-n-TTTCRTAT AAL82287.1 Q15, K16, R27, Q30, K34, D35 3MLF Yes [1]
φ13 AF424783 AAL82333.1 P29, Y30, S41, S44, N48, D49 AGTTCATR-n3-CRTGAAYT AAL82334.1 TSAAYAAAA Yes [1]
φ80α DQ517338 ABF71577.1 Q19, S20, N31, S34, N38, G39 WTGTACAK-n4-CYGWACAA ABF71578.1 Q21, S22, T33, N36, Q40, G41 TWCATWT Yes [2]
φCA347 M18, E19, G38, S41, N45, E46 WCGAAACW Q24, K25, S36, S39, N46, G47 YRACAACTW Yes [3]
φNM1 AP009351 BAF68084.1 K18, V19, G30, R33, S37, G38 [4]
φST9-B L18, Q19, G41, S44, N48, N49 N18, K19, T30, N33, N37, N40
φX2 AY954968 AAX92026.1 V18, K19, T30, R33, R38, G39 ATACGAAAA AAX92036.1 [5]
Prophage Prototype Accession Number cI* protein DNA-binding residues Crystal Structure cI* Operator mor protein DNA-binding residues Crystal Structure        mor Operator        ci*-mor heterodimer References
80 Q25, V26, S37, S40, K44, E45 TATYAC-n5-GTRATA              Q21, Q22, Q33, I36, K40, D41 [6]
88 AY954966 AAX91907.1 Q21, T22, S33, S36, N40, A41 AAX91914.1 Q21, E22, A33, I36, K40, G41 [7]
Mu3 WP_000429766.1 Q25, R26, P37, S40, Q44, Q45 GTAATA WP_001115060.1 Q18, Q19, K30, G33, K37, D38 [8]
ROSA NC_007058 YP_240340.1 L22, T23, S34, S37, N41, G42 YP_240342.1 I20, S21, G32, S35, N39, G40 [9]
SA675 L22, S23, S34, S37, N41, L42 Q19, D20, R31, A35, D39, G40 [10]
SA75 MT013111 QIA28762.1 GAAATKTR QIA28763.1 N21, K22, A33, S36, R40, G41 [11]
SLT AB045978 BAB21700.1 L18, A19, A30, Q33, S37, G38 AAAASTTTMG I19, K20, D31, S34, H38, G39 [12]

For annotation of individual genomes, a recommended naming convention would be to use the prophage prototype in the description, as in "prophage φ12-like induction repressor cI" for SAUSA300_1969 from strain USA300_FPR3757.


⊟Orthologs[edit | edit source]

    COL:
    —
    N315:
    SA1805
    NCTC8325:
    SAOUHSC_01575
    Newman:
    NWMN_1921
    USA300_FPR3757:
    SAUSA300_1969
    04-02981:
    SA2981_1959
    08BA02176:
    —
    11819-97:
    MS7_2029
    6850:
    —
    71193:
    ST398NM01_1552
    ECT-R 2:
    ECTR2_1868
    ED133:
    —
    ED98:
    —
    HO 5096 0412:
    SAEMRSA15_19200
    JH1:
    SaurJH1_2091
    JH9:
    SaurJH9_2054
    JKD6008:
    SAA6008_02051
    JKD6159:
    SAA6159_01932
    LGA251:
    —
    M013:
    —
    MRSA252:
    SAR2100
    MSHR1132:
    —
    MSSA476:
    —
    Mu3:
    SAHV_1984
    Mu50:
    SAV1998
    MW2:
    —
    RF122:
    —
    ST398:
    —
    T0131:
    SAT0131_02132
    TCH60:
    —
    TW20:
    SATW20_19950
    USA300_TCH1516:
    USA300HOU_2004
    VC40:
    —

⊟Genome Viewer[edit | edit source]

N315
NCTC8325
Newman
USA300_FPR3757

⊟Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    N315            MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
    NCTC8325        MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
    Newman          MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
    USA300_FPR3757  MNKERNIIIAKNIRKFLNDSNMSQKKLAELINIKPSTLSDYLNLRSNPSHGVIQRIADVF
                    ************************************************************

    N315            EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
    NCTC8325        EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
    Newman          EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
    USA300_FPR3757  EVGKSDIDTTYKDDNDITSIYNKLTPPRQENVLNYANEQLEEQNSKGDNVVDINSYKQEK
                    ************************************************************

    N315            TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
    NCTC8325        TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
    Newman          TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
    USA300_FPR3757  TPVNVNGCVSAGVGERLHDETLFTEMVKGPIPTHDLALKVNGDSMEPMFKDGEIIFVEKT
                    ************************************************************

    N315            HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
    NCTC8325        HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
    Newman          HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
    USA300_FPR3757  HNIKNGQIGIFIIEEEAYVKKVFVEDDRLTLVSLNKDYDDLHFYRNESVRLIGKVIL
                    *********************************************************

  1. ↑ 1.0 1.1 1.2 John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Anindya Biswas, Sukhendu Mandal, Subrata Sau
    Identification and characterization of a CI binding operator at a distant location in the temperate staphylococcal phage ф11.
    FEMS Microbiol Lett: 2017, 364(20);
    [PubMed:28961814] [WorldCat.org] [DOI] (I p)    Mohammed A Thabet, José R Penadés, Andreas F Haag
    The ClpX protease is essential for inactivating the CI master repressor and completing prophage induction in Staphylococcus aureus.
    Nat Commun: 2023, 14(1);6599
    [PubMed:37852980] [WorldCat.org] [DOI] (I e)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  2. ↑ Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  3. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  4. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  5. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  6. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  7. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  8. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  9. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  10. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  11. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
  12. ↑ John J Iandolo, Veronica Worrell, Kajetan H Groicher, Yudong Qian, Runying Tian, Steve Kenton, Angela Dorman, Honggui Ji, Shaoping Lin, Phoebe Loh, Sulan Qi, Hua Zhu, B A Roe
    Comparative analysis of the genomes of the temperate bacteriophages phi 11, phi 12 and phi 13 of Staphylococcus aureus 8325.
    Gene: 2002, 289(1-2);109-18
    [PubMed:12036589] [WorldCat.org] [DOI] (P p)    Jennifer M Auchtung, Catherine A Lee, Katherine L Garrison, Alan D Grossman
    Identification and characterization of the immunity repressor (ImmR) that controls the mobile genetic element ICEBs1 of Bacillus subtilis.
    Mol Microbiol: 2007, 64(6);1515-28
    [PubMed:17511812] [WorldCat.org] [DOI] (P p)    Baundauna Bose, Jennifer M Auchtung, Catherine A Lee, Alan D Grossman
    A conserved anti-repressor controls horizontal gene transfer by proteolysis.
    Mol Microbiol: 2008, 70(3);570-82
    [PubMed:18761623] [WorldCat.org] [DOI] (I p)    Margit Pedersen, Karin Hammer
    The role of MOR and the CI operator sites on the genetic switch of the temperate bacteriophage TP901-1.
    J Mol Biol: 2008, 384(3);577-89
    [PubMed:18930065] [WorldCat.org] [DOI] (I p)    Tal Argov, Shai Ran Sapir, Anna Pasechnek, Gil Azulay, Olga Stadnyuk, Lev Rabinovich, Nadejda Sigal, Ilya Borovok, Anat A Herskovits
    Coordination of cohabiting phage elements supports bacteria-phage cooperation.
    Nat Commun: 2019, 10(1);5288
    [PubMed:31754112] [WorldCat.org] [DOI] (I e)    Camilla S Kristensen, Anders K Varming, Helena A K Leinweber, Karin Hammer, Leila Lo Leggio, Hanne Ingmer, Mogens Kilstrup
    Characterization of the genetic switch from phage ɸ13 important for Staphylococcus aureus colonization in humans.
    Microbiologyopen: 2021, 10(5);e1245
    [PubMed:34713608] [WorldCat.org] [DOI] (I p)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUPAN005125000&oldid=105173"