From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01681
  • pan locus tag?: SAUPAN004161000
  • symbol: prmA
  • pan gene symbol?: prmA
  • synonym:
  • product: ribosomal protein L11 methyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01681
  • symbol: prmA
  • product: ribosomal protein L11 methyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1590396..1591334
  • length: 939
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAACTGGACAGAGCTTTCAATTATTATTAATCATGAAGCAGTAGAATTGGCTACCAAT
    ATACTTGAAAATCATGGATCAAATGGTGTCGTGATAGAAGATTCAGATGATTTAATTAAC
    CAACCAGAAGATAAATACGGTGAAATTTACGCTTTGAAAAAAGAGGATTATCCAGATAAG
    GGAGTAAGATTGAAAGCCTATTTTAATGAAATGACTTATGATGATAAGTTGCGACAGCAA
    ATTAAAGATGAGTTATTAAATTTAGATGAACTTGATCAACATAACGTTCAATTCAGTGAG
    CAAATTATTGCAGAGACGGATTGGGAAAATGAATGGAAAAACTATTTCCATCCATTCCGA
    GCGTCGAAGAAGTTCACAATAGTTCCTAGTTGGGAAACATATGCTAAAGAAGCGGATGAA
    GAGCTTTGCATTGAGCTCGACCCAGGTATGGCTTTTGGAACAGGTGATCATCCGACTACA
    AGTATGTGTTTGAAGGCAATAGAAACATATGTATTGCCACAGCATTCAGTAATTGATGTT
    GGTACTGGCTCAGGTATATTAAGTATTGCAAGTCATCTAATCGGTGTAAAACGTATTAAA
    GCGTTGGATATTGATGAAATGGCAGTGAGTGTAGCTAAAGAAAACTTCAGAAGAAATCAT
    TGTGAAACGTTAATTGAAGCTGTTCCAGGTAACTTATTGAAAGACGAAACAGAAAAATTT
    GATATTGTAATAGCAAATATTTTAGCGCATATTATTGATGAAATGATTGAAGATGCTTAT
    AATACTCTAAATGAAGGCGGTTATTTTATTACTTCTGGTATTATAAAAGAGAAGTATGAA
    GGTATACAGTCACATATGGAGCGTGTAGGTTTTAAAATTATTTCAGAACAACATGACAAC
    GGTTGGGTTTGTCTTGTTGGCCAGAAAGTGAGTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    939

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01681
  • symbol: PrmA
  • description: ribosomal protein L11 methyltransferase
  • length: 312
  • theoretical pI: 4.33956
  • theoretical MW: 35512.7
  • GRAVY: -0.376923

Function[edit | edit source]

  • reaction:
    EC 2.1.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 257.9)
    and 13 more
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 45.4)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 39.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 37.6)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 37.6)
    Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 36.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 32)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 30.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 24.5)
    methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 18.3)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 17)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 16.2)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 15.5)
    Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 14.6)
  • TheSEED:  
    Protein Metabolism Protein biosynthesis Ribosome biogenesis bacterial  Ribosomal protein L11 methyltransferase (EC 2.1.1.-)
    and 1 more
    Stress Response Heat shock Heat shock dnaK gene cluster extended  Ribosomal protein L11 methyltransferase (EC 2.1.1.-)
  • PFAM:
    NADP_Rossmann (CL0063) PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 355.5)
    and 14 more
    MTS; Methyltransferase small domain (PF05175; HMM-score: 55.4)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 40.1)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 36.3)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 35.9)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 30.9)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 28)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 24.8)
    Met_10; Met-10+ like-protein (PF02475; HMM-score: 18.6)
    Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 17.7)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 17.4)
    Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 15.7)
    UPF0020; Putative RNA methylase family UPF0020 (PF01170; HMM-score: 13)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 12.9)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 12)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007117
    • TAT(Tat/SPI): 0.000217
    • LIPO(Sec/SPII): 0.000972
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDKGVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFRASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDVGTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKFDIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDNGWVCLVGQKVSE

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]