From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02536
  • pan locus tag?: SAUPAN005729000
  • symbol: SAOUHSC_02536
  • pan gene symbol?: moaA
  • synonym:
  • product: molybdenum cofactor biosynthesis protein A

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02536
  • symbol: SAOUHSC_02536
  • product: molybdenum cofactor biosynthesis protein A
  • replicon: chromosome
  • strand: -
  • coordinates: 2336046..2337068
  • length: 1023
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGGTAGAACAAATAAAAGATAAACTAGGACGTCCCATCCGTGACTTACGGTTATCTGTG
    ACAGATCGGTGTAACTTTAGGTGTGATTATTGCATGCCTAAAGAGGTATTTGGAGATGAT
    TTCGTATTTTTACCTAAAAATGAACTTTTAACGTTTGATGAAATGGCTAGAATCGCTAAG
    GTATATGCAGAATTAGGTGTAAAAAAAATACGCATTACAGGTGGAGAACCATTGATGCGA
    CGGGATTTAGATGTACTTATAGCTAAATTAAATCAAATCGATGGTATTGAAGATATTGGT
    TTGACTACAAATGGTTTGTTATTAAAAAAGCATGGACAAAAGTTATATGATGCTGGGCTG
    CGCAGAATTAATGTCAGTTTGGATGCTATTGATGATACGCTATTTCAATCAATCAATAAT
    CGTAATATTAAAGCGACTACGATTTTAGAACAAATTGATTACGCGACGTCTATTGGTTTG
    AATGTAAAAGTAAATGTTGTTATACAAAAAGGTATTAACGATGATCAAATCATACCAATG
    CTTGAATATTTTAAAGATAAACATATAGAGATTCGATTTATAGAATTTATGGATGTTGGT
    AATGATAATGGATGGGATTTCAGTAAAGTTGTAACTAAAGATGAAATGCTTACAATGATA
    GAGCAGCACTTTGAAATCGATCCTGTAGAACCAAAATATTTTGGGGAAGTAGCAAAATAT
    TATCGCCATAAGGATAATGGTGTTCAATTTGGTTTGATTACAAGTGTTTCACAATCATTT
    TGTTCTACATGTACACGCGCAAGGCTGTCATCAGATGGGAAGTTTTACGGATGTTTATTT
    GCAACTGTCGATGGATTTAACGTTAAAGCGTTTATTCGTTCTGGCGTGACCGACGAAGAA
    TTAAAAGAACAATTTAAAGCTTTATGGCAAATAAGAGATGATCGATATTCAGATGAGAGA
    ACTGCTCAAACAGTTGCCAATCGTCAACGTAAAAAGATAAACATGAATTATATTGGTGGT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1023

Protein[edit | edit source]

Protein Data Bank: 1TV7
Protein Data Bank: 1TV8
Protein Data Bank: 2FB2
Protein Data Bank: 2FB3

General[edit | edit source]

  • locus tag: SAOUHSC_02536
  • symbol: SAOUHSC_02536
  • description: molybdenum cofactor biosynthesis protein A
  • length: 340
  • theoretical pI: 6.53074
  • theoretical MW: 39077.6
  • GRAVY: -0.343529

Function[edit | edit source]

  • reaction:
    EC 4.1.99.22?  ExPASy
    GTP 3',8-cyclase GTP + S-adenosyl-L-methionine + reduced electron acceptor = (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate + 5'-deoxyadenosine + L-methionine + oxidized electron acceptor
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 402.8)
    and 63 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin probable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 233.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other coenzyme PQQ biosynthesis enzyme PqqE (TIGR02109; HMM-score: 61.3)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 59.1)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 52.2)
    putative metalloenzyme radical SAM/SPASM domain maturase (TIGR04311; HMM-score: 51.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 48.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 46.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin 12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 46.7)
    radical SAM enzyme, rSAM/lipoprotein system (TIGR04133; HMM-score: 44.9)
    GeoRSP system radical SAM/SPASM protein (TIGR04303; HMM-score: 43.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 41.8)
    Cellular processes Cellular processes Toxin production and resistance cytosylglucuronate decarboxylase (TIGR04466; EC 4.1.-.-; HMM-score: 41.8)
    Unknown function Enzymes of unknown specificity radical SAM protein, BA_1875 family (TIGR04053; HMM-score: 41.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 41)
    hopanoid biosynthesis associated radical SAM protein HpnH (TIGR03470; HMM-score: 40.6)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 35.5)
    peptide-modifying radical SAM enzyme CbpB (TIGR04163; HMM-score: 34)
    radical SAM protein, TatD family-associated (TIGR04038; HMM-score: 33.7)
    radical SAM peptide maturase, GG-Bacteroidales family (TIGR04148; HMM-score: 33.1)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 33)
    Unknown function Enzymes of unknown specificity archaeal radical SAM protein, PTO1314 family (TIGR03961; HMM-score: 32.8)
    antiviral radical SAM protein viperin (TIGR04278; HMM-score: 32.4)
    Genetic information processing Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 32.3)
    nif11-class peptide radical SAM maturase 3 (TIGR04103; HMM-score: 31.9)
    Unknown function Enzymes of unknown specificity Y_X(10)_GDL-associated radical SAM protein (TIGR03913; HMM-score: 30.1)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 30.1)
    radical SAM/SPASM domain protein, FxsB family (TIGR04269; HMM-score: 30.1)
    Unknown function Enzymes of unknown specificity mycofactocin radical SAM maturase (TIGR03962; HMM-score: 29.8)
    arginine 2,3-aminomutase (TIGR04468; EC 5.4.3.-; HMM-score: 29.7)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 29)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 29)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin biotin synthase (TIGR00433; EC 2.8.1.6; HMM-score: 26.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other nitrogenase cofactor biosynthesis protein NifB (TIGR01290; HMM-score: 26.3)
    Metabolism Central intermediary metabolism Nitrogen fixation nitrogenase cofactor biosynthesis protein NifB (TIGR01290; HMM-score: 26.3)
    radical SAM/Cys-rich domain protein (TIGR04167; HMM-score: 26.3)
    Cellular processes Cellular processes Toxin production and resistance Cys-rich peptide radical SAM maturase CcpM (TIGR04068; HMM-score: 25.5)
    sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 24.5)
    Genetic information processing Protein fate Protein modification and repair KxxxW cyclic peptide radical SAM maturase (TIGR04080; HMM-score: 24.4)
    Cellular processes Cellular processes Adaptations to atypical conditions KamA family protein (TIGR00238; HMM-score: 23.7)
    Cellular processes Cellular processes Biosynthesis of natural products SCIFF radical SAM maturase (TIGR03974; HMM-score: 23.6)
    radical SAM/SPASM domain protein, ACGX system (TIGR04340; HMM-score: 23.6)
    pseudo-rSAM protein, GG-Bacteroidales system (TIGR04150; HMM-score: 21.4)
    lysine-2,3-aminomutase-related protein (TIGR03822; EC 5.4.3.-; HMM-score: 21)
    radical SAM enzyme, TIGR04100 family (TIGR04100; HMM-score: 20.6)
    putative peptide-modifying radical SAM enzyme, AF0577 family (TIGR04084; HMM-score: 20.2)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 18.9)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 18.7)
    Unknown function Enzymes of unknown specificity radical SAM/CxCxxxxC motif protein YfkAB (TIGR04478; HMM-score: 18.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification wyosine biosynthesis protein TYW1 (TIGR03972; HMM-score: 17.6)
    radical SAM/SPASM domain peptide maturase, XyeB family (TIGR04496; HMM-score: 17.2)
    Genetic information processing Protein fate Protein modification and repair EF-P beta-lysylation protein EpmB (TIGR03821; EC 5.4.3.-; HMM-score: 16.8)
    lysine-2,3-aminomutase (TIGR03820; EC 5.4.3.2; HMM-score: 16.6)
    putative radical SAM enzyme, TIGR03279 family (TIGR03279; HMM-score: 16.5)
    Genetic information processing Protein fate Protein modification and repair anaerobic sulfatase maturase (TIGR03942; EC 1.1.99.-; HMM-score: 16)
    Cellular processes Cellular processes Toxin production and resistance nif11-like peptide radical SAM maturase (TIGR04064; HMM-score: 15.6)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA repair protein rad18 (TIGR00599; HMM-score: 15.4)
    Genetic information processing Protein fate Protein modification and repair quinohemoprotein amine dehydrogenase maturation protein (TIGR03906; HMM-score: 14.1)
    radical SAM/SPASM domain protein maturase (TIGR04463; HMM-score: 14)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 13.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit (TIGR03551; EC 2.5.1.77; HMM-score: 12)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit (TIGR03550; EC 2.5.1.77; HMM-score: 11.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other homocitrate synthase (TIGR02660; EC 2.3.3.14; HMM-score: 11)
    Metabolism Central intermediary metabolism Nitrogen fixation homocitrate synthase (TIGR02660; EC 2.3.3.14; HMM-score: 11)
  • TheSEED  :
    • GTP 3',8-cyclase (EC 4.1.99.22)
    Cofactors, Vitamins, Prosthetic Groups, Pigments Folate and pterines Molybdenum cofactor biosynthesis  Cyclic pyranopterin phosphate synthase (MoaA) (EC 4.1.99.18)
  • PFAM:
    no clan defined Mob_synth_C; Molybdenum Cofactor Synthesis C (PF06463; HMM-score: 131.4)
    and 5 more
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 90.9)
    4Fe-4S (CL0344) Fer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 30.6)
    Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 30.3)
    no clan defined DUF520; Protein of unknown function (DUF520) (PF04461; HMM-score: 13.4)
    DNA_primase_lrg (CL0242) DNA_primase_lrg; Eukaryotic and archaeal DNA primase, large subunit (PF04104; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: [4Fe-4S] cluster
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007959
    • TAT(Tat/SPI): 0.000492
    • LIPO(Sec/SPII): 0.001254
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Petra Hänzelmann, Hermann Schindelin
Crystal structure of the S-adenosylmethionine-dependent enzyme MoaA and its implications for molybdenum cofactor deficiency in humans.
Proc Natl Acad Sci U S A: 2004, 101(35);12870-5
[PubMed:15317939] [WorldCat.org] [DOI] (P p)
Petra Hänzelmann, Hermann Schindelin
Binding of 5'-GTP to the C-terminal FeS cluster of the radical S-adenosylmethionine enzyme MoaA provides insights into its mechanism.
Proc Natl Acad Sci U S A: 2006, 103(18);6829-34
[PubMed:16632608] [WorldCat.org] [DOI] (P p)
Nicholas S Lees, Petra Hänzelmann, Heather L Hernandez, Sowmya Subramanian, Hermann Schindelin, Michael K Johnson, Brian M Hoffman
ENDOR spectroscopy shows that guanine N1 binds to [4Fe-4S] cluster II of the S-adenosylmethionine-dependent enzyme MoaA: mechanistic implications.
J Am Chem Soc: 2009, 131(26);9184-5
[PubMed:19566093] [WorldCat.org] [DOI] (I p)