From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02541
  • pan locus tag?: SAUPAN005733000
  • symbol: SAOUHSC_02541
  • pan gene symbol?: mobB
  • synonym:
  • product: molybdopterin-guanine dinucleotide biosynthesis protein MobB

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02541
  • symbol: SAOUHSC_02541
  • product: molybdopterin-guanine dinucleotide biosynthesis protein MobB
  • replicon: chromosome
  • strand: -
  • coordinates: 2338393..2338878
  • length: 486
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTTTACAAATTGTAGGTTACAAAAAGTCTGGTAAGACAACATTGATGAGGCATATT
    GTCTCTTTCTTAAAGTCACATGGTTATACAGTTGCTACTATTAAACATCATGGGCATGGT
    AAGGAAGATATTCAATTACAGGATTCAGACGTCGATCACATGAAGCATTTTGAAGCGGGG
    GCAGATCAAAGTATTGTACAAGGTTTTCAATATCAGCAAACTGTAACACGTGTAGATAAT
    CAAAATCTTACTCAAATTATTGAAAAATCTGTTACAATTGACACCAATATCGTATTAGTT
    GAAGGCTTTAAAAATGCTGATTTTGAAAAAGTCGTAGTCTATCGAAATGAAGAAGAGTTG
    CAAGTATTACAACAATTGTCGAATGTTTGTTATAGCATTAATGTAAGGGAGCATGAAGAT
    TTTACAGCATTTGAGCAATGGTTATTAAATAAAATTAAAAATGATTGTGATACACAATTA
    ACATAG
    60
    120
    180
    240
    300
    360
    420
    480
    486

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_02541
  • symbol: SAOUHSC_02541
  • description: molybdopterin-guanine dinucleotide biosynthesis protein MobB
  • length: 161
  • theoretical pI: 6.07381
  • theoretical MW: 18568.8
  • GRAVY: -0.43913

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 133.4)
    and 9 more
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 16.5)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 14.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.6)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.9)
    Metabolism Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01807; EC 5.4.99.5; HMM-score: 12.4)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.1)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 11.8)
    Cellular processes Cellular processes Sporulation and germination stage V sporulation protein B (TIGR02900; HMM-score: 11.4)
  • TheSEED  :
    • Molybdopterin-guanine dinucleotide biosynthesis protein MobB
    Cofactors, Vitamins, Prosthetic Groups, Pigments Folate and pterines Molybdenum cofactor biosynthesis  Molybdopterin-guanine dinucleotide biosynthesis protein MobB
  • PFAM:
    P-loop_NTPase (CL0023) MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 98.7)
    and 13 more
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 20.5)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 17.9)
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 15.6)
    P-loop_NTPase (CL0023) AAA_26; AAA domain (PF13500; HMM-score: 15.5)
    AAA_30; AAA domain (PF13604; HMM-score: 14.6)
    AAA_14; AAA domain (PF13173; HMM-score: 14)
    NTPase_1; NTPase (PF03266; HMM-score: 13.9)
    AAA_18; AAA domain (PF13238; HMM-score: 13.4)
    ABC_tran; ABC transporter (PF00005; HMM-score: 12.9)
    DUF2478; Protein of unknown function (DUF2478) (PF10649; HMM-score: 12.9)
    AAA_22; AAA domain (PF13401; HMM-score: 12.7)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.3)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014661
    • TAT(Tat/SPI): 0.000551
    • LIPO(Sec/SPII): 0.00264
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAGADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEELQVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_02541&oldid=77365"