From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2265 [new locus tag: SACOL_RS11910 ]
  • pan locus tag?: SAUPAN005733000
  • symbol: mobB
  • pan gene symbol?: mobB
  • synonym:
  • product: molybdopterin-guanine dinucleotide biosynthesis protein B

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2265 [new locus tag: SACOL_RS11910 ]
  • symbol: mobB
  • product: molybdopterin-guanine dinucleotide biosynthesis protein B
  • replicon: chromosome
  • strand: -
  • coordinates: 2327738..2328223
  • length: 486
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTTTACAAATTGTAGGTTACAAAAAGTCTGGTAAGACAACATTGATGAGGCATATT
    GTCTCTTTCTTAAAGTCACATGGTTATACAGTTGCTACTATTAAACATCATGGGCATGGT
    AAGGAAGATATTCAATTACAGGATTCAGACGTCGATCACATGAAGCATTTTGAAGCGGGG
    GCAGATCAAAGTATTGTACAAGGTTTTCAATATCAGCAAACTGTAACACGTGTAGATAAT
    CAAAATCTTACTCAAATTATTGAAAAATCTGTTACAATTGACACCAATATCGTATTAGTT
    GAAGGCTTTAAAAATGCTGATTTTGAAAAAGTCGTAGTCTATCGAAATGAAGAAGAGTTG
    CAAGTATTACAACAATTGTCGAATGTTTGTTATAGCATTAATGTAAGGGAGCATGAAGAT
    TTTACAGCATTTGAGCAATGGTTATTAAATAAAATTAAAAATGATTGTGATACACAATTA
    ACATAG
    60
    120
    180
    240
    300
    360
    420
    480
    486

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2265 [new locus tag: SACOL_RS11910 ]
  • symbol: MobB
  • description: molybdopterin-guanine dinucleotide biosynthesis protein B
  • length: 161
  • theoretical pI: 6.07381
  • theoretical MW: 18568.8
  • GRAVY: -0.43913

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 133.4)
    and 9 more
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 16.5)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 14.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.6)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 13.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.9)
    Metabolism Amino acid biosynthesis Aromatic amino acid family chorismate mutase (TIGR01807; EC 5.4.99.5; HMM-score: 12.4)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.1)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 11.8)
    Cellular processes Cellular processes Sporulation and germination stage V sporulation protein B (TIGR02900; HMM-score: 11.4)
  • TheSEED  :
    • Molybdopterin-guanine dinucleotide biosynthesis protein MobB
    Cofactors, Vitamins, Prosthetic Groups, Pigments Folate and pterines Molybdenum cofactor biosynthesis  Molybdopterin-guanine dinucleotide biosynthesis protein MobB
  • PFAM:
    P-loop_NTPase (CL0023) MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 98.7)
    and 13 more
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 20.5)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 17.9)
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 15.6)
    P-loop_NTPase (CL0023) AAA_26; AAA domain (PF13500; HMM-score: 15.5)
    AAA_30; AAA domain (PF13604; HMM-score: 14.6)
    AAA_14; AAA domain (PF13173; HMM-score: 14)
    NTPase_1; NTPase (PF03266; HMM-score: 13.9)
    AAA_18; AAA domain (PF13238; HMM-score: 13.4)
    ABC_tran; ABC transporter (PF00005; HMM-score: 12.9)
    DUF2478; Protein of unknown function (DUF2478) (PF10649; HMM-score: 12.9)
    AAA_22; AAA domain (PF13401; HMM-score: 12.7)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.3)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014661
    • TAT(Tat/SPI): 0.000551
    • LIPO(Sec/SPII): 0.00264
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MILQIVGYKKSGKTTLMRHIVSFLKSHGYTVATIKHHGHGKEDIQLQDSDVDHMKHFEAGADQSIVQGFQYQQTVTRVDNQNLTQIIEKSVTIDTNIVLVEGFKNADFEKVVVYRNEEELQVLQQLSNVCYSINVREHEDFTAFEQWLLNKIKNDCDTQLT

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 61 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL2265&oldid=92227"