Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2263 [new locus tag: SACOL_RS11900 ]
- pan locus tag?: SAUPAN005731000
- symbol: moaD
- pan gene symbol?: moaD
- synonym:
- product: molybdopterin converting factor subunit 1
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2263 [new locus tag: SACOL_RS11900 ]
- symbol: moaD
- product: molybdopterin converting factor subunit 1
- replicon: chromosome
- strand: -
- coordinates: 2327039..2327272
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238395 NCBI
- RefSeq: YP_187070 NCBI
- BioCyc: see SACOL_RS11900
- MicrobesOnline: 913745 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAGGTACTTTACTTCGCAGAAATTAAAGATATATTACAAAAAGCACAGGAAGATATT
GTGCTTGAACAAGCATTGACTGTACAACAATTTGAAGATTTATTGTTTGAACGTTATCCG
CAAATCAATAATAAAAAGTTTCAAGTTGCTGTAAATGAGGAATTTGTACAAAAATCGGAT
TTCATTCAACCTAATGATACTGTTGCATTAATTCCACCGGTTAGTGGAGGTTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2263 [new locus tag: SACOL_RS11900 ]
- symbol: MoaD
- description: molybdopterin converting factor subunit 1
- length: 77
- theoretical pI: 4.19545
- theoretical MW: 8871.09
- GRAVY: -0.172727
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin converting factor, subunit 1 (TIGR01682; HMM-score: 76.7)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin MoaD family protein (TIGR01687; HMM-score: 40.8)Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine thiamine biosynthesis protein ThiS (TIGR01683; HMM-score: 16.2)
- TheSEED :
- Molybdopterin synthase sulfur carrier subunit
- PFAM: Ubiquitin (CL0072) ThiS; ThiS family (PF02597; HMM-score: 67.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9917
- Cytoplasmic Membrane Score: 0.0073
- Cell wall & surface Score: 0
- Extracellular Score: 0.001
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00173
- TAT(Tat/SPI): 0.00019
- LIPO(Sec/SPII): 0.000286
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell: 81 [2]
- interaction partners:
SACOL1637 (dnaK) molecular chaperone DnaK [3] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [3] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [3] (data from MRSA252) SACOL0593 (fusA) elongation factor G [3] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [3] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [3] (data from MRSA252) SACOL1477 (ilvA1) threonine dehydratase [3] (data from MRSA252) SACOL1288 (infB) translation initiation factor IF-2 [3] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [3] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [3] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [3] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [3] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [3] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [3] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [3] (data from MRSA252) SACOL0015 (rplI) 50S ribosomal protein L9 [3] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [3] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [3] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [3] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [3] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [3] (data from MRSA252) SACOL2228 (rplX) 50S ribosomal protein L24 [3] (data from MRSA252) SACOL2112 (rpmE2) 50S ribosomal protein L31 [3] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [3] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [3] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [3] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [3] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [3] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [3] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [3] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [3] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [3] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [3] (data from MRSA252) SACOL0688 ABC transporter substrate-binding protein [3] (data from MRSA252) SACOL0944 NADH dehydrogenase [3] (data from MRSA252) SACOL1759 universal stress protein [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 3.11 3.12 3.13 3.14 3.15 3.16 3.17 3.18 3.19 3.20 3.21 3.22 3.23 3.24 3.25 3.26 3.27 3.28 3.29 3.30 3.31 3.32 3.33 3.34 3.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)