Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02630
- pan locus tag?: SAUPAN005853000
- symbol: SAOUHSC_02630
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02630
- symbol: SAOUHSC_02630
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2418795..2419442
- length: 648
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921407 NCBI
- RefSeq: YP_501091 NCBI
- BioCyc: G1I0R-2481 BioCyc
- MicrobesOnline: 1291062 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAAAAGATGATATTAATTAATGTCATTACGGTTGTTGTACTGTTAGCAATTGGGATT
GCTGGCTTTTATTTTTGGAATAAAACAACAAGCTATGTAACAACTGATAATGCAAAAGTA
AATGGCGATCAAATTAAAATAGCAAGTCCTGCATCTGGACAAATTAAATCACTTAATGTT
AAACAAGGTGACAAACTCGATAAAGGTGACAAAGTAGCAATTGTTACTGTACAAGGTCAA
GATGGCGAAACGAAAGATATGGATCTTAAAATGCCTCAAAAAGGTACAATTGCCAAATTA
GATGGTATGGAAGGTTCAATGGTGCAAGCTGGTAACCCAATCGCTTATGCATACAATTTA
GATGATTTATATGTAACAGCAAATATTGACGAAAAAGATATTAAAGATGTTGAAGTAGGT
AAAGATGTTGATGTGACTATTGACGGTCAAAAAGCTTCTATTAAAGGTAAAGTTGATAGT
ATTGGAAAAGCAACTGCTGCAAGCTTTTCATTAATGCCATCATCAAATAGTGATGGTAAC
TACACTAAAGTTTCTCAAGTAATACCTGTTAAAATCACTCTAGAATCAGAACCGTCTAAA
CAAGTTGTTCCTGGAATGAACGCTGAAGTAAAAATCCATAAAAATTAA60
120
180
240
300
360
420
480
540
600
648
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02630
- symbol: SAOUHSC_02630
- description: hypothetical protein
- length: 215
- theoretical pI: 7.49286
- theoretical MW: 23024.3
- GRAVY: -0.206977
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Other efflux pump membrane protein (TIGR00998; HMM-score: 126.2)and 12 moreTransport and binding proteins Unknown substrate efflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 45.5)ABC exporter membrane fusion protein, DevB family (TIGR02971; HMM-score: 44.2)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 39.3)Transport and binding proteins Other membrane fusion protein cluster 2 protein (TIGR00999; HMM-score: 31.5)Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 24.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 24.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 24.1)Energy metabolism Glycolysis/gluconeogenesis pyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 17.8)Energy metabolism Pyruvate dehydrogenase dihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 17.4)Transport and binding proteins Cations and iron carrying compounds oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 14.6)Energy metabolism Other oxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 14.6)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 14)
- TheSEED :
- Multidrug resistance protein [function not yet clear]
- PFAM: Hybrid (CL0105) HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 62.5)HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 55.1)and 9 moreBiotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 37)Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 36.2)HlyD_2; HlyD family secretion protein (PF12700; HMM-score: 29.1)ALR_C-like (CL0866) CusB_dom_1; Cation efflux system protein CusB domain 1 (PF00529; HMM-score: 16.1)Hybrid (CL0105) DUF2118; Uncharacterized protein conserved in archaea (DUF2118) (PF09891; HMM-score: 14.7)Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 14.2)no clan defined DUF6672; Family of unknown function (DUF6672) (PF20377; HMM-score: 13.8)DUF3221; Protein of unknown function (DUF3221) (PF11518; HMM-score: 13.3)E-set (CL0159) Psg1; Ykl077w/Psg1 (Pma1 Stabilization in Golgi) (PF14610; HMM-score: 8.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9977
- Cell wall & surface Score: 0
- Extracellular Score: 0.0023
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.367511
- TAT(Tat/SPI): 0.000603
- LIPO(Sec/SPII): 0.070569
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKMILINVITVVVLLAIGIAGFYFWNKTTSYVTTDNAKVNGDQIKIASPASGQIKSLNVKQGDKLDKGDKVAIVTVQGQDGETKDMDLKMPQKGTIAKLDGMEGSMVQAGNPIAYAYNLDDLYVTANIDEKDIKDVEVGKDVDVTIDGQKASIKGKVDSIGKATAASFSLMPSSNSDGNYTKVSQVIPVKITLESEPSKQVVPGMNAEVKIHKN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
