Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02777
- pan locus tag?: SAUPAN006049000
- symbol: SAOUHSC_02777
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02777
- symbol: SAOUHSC_02777
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2553735..2554157
- length: 423
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921432 NCBI
- RefSeq: YP_501237 NCBI
- BioCyc: G1I0R-2617 BioCyc
- MicrobesOnline: 1291208 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAACAAAAAACATGTTTTTATAATTATTGGTGTCATTTTATGTATATGTATAGTTGCA
TCAGTCATTTATTTAAAAGTGAAATATGACGAAAAAGAAAAACAAAAAGCAATATACTAT
AAAGAACAACAGGAGCGTATTACACTCTATCTTAAGCATAATACTAAAGAACCCAATACC
ATCAAAACTGTACATTTCACAAGTTTAAAAAGAGGACCTATGGGCGATGCAGTAATTGAA
GGTTACATAAATGAAAATAAAGAAGATGATTTTGTTGCATATGGGTCTCCAGAACATAAT
TATCAATTTGGTGGAAGTTTAATCAAAAGTAAAAATTTAAGCACGTTATTAAAACCAGTA
CATCAAACCAAATCACCTGATGAGATAAAAAAGGAATTAGAGTCTAAAAAGAACGACCGC
TAA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02777
- symbol: SAOUHSC_02777
- description: hypothetical protein
- length: 140
- theoretical pI: 9.61055
- theoretical MW: 16201.6
- GRAVY: -0.617143
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 15.7)Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 13.2)Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 12.8)
- TheSEED :
- FIG01108221: hypothetical protein
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 134.6)and 8 moreViral_Beta_CD; Viral Beta C/D like family (PF04530; HMM-score: 15.7)DUF1310; Protein of unknown function (DUF1310) (PF07006; HMM-score: 14.9)Sec66; Preprotein translocase subunit Sec66 (PF09802; HMM-score: 14.8)TrbC_VirB2 (CL0690) T4SS_pilin; Type IV secretion system pilin (PF18895; HMM-score: 13.8)no clan defined DUF7299; Family of unknown function (DUF7299) (PF23973; HMM-score: 13.7)DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 12.5)ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 11.7)no clan defined PMP1_2; ATPase proteolipid family (PF08114; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.597
- Cell wall & surface Score: 0.0017
- Extracellular Score: 0.4012
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.225666
- TAT(Tat/SPI): 0.002545
- LIPO(Sec/SPII): 0.095256
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNKKHVFIIIGVILCICIVASVIYLKVKYDEKEKQKAIYYKEQQERITLYLKHNTKEPNTIKTVHFTSLKRGPMGDAVIEGYINENKEDDFVAYGSPEHNYQFGGSLIKSKNLSTLLKPVHQTKSPDEIKKELESKKNDR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [1] : SAOUHSC_02777 < S1082 < SAOUHSC_02778predicted SigA promoter [1] : SAOUHSC_02777 < S1082 < SAOUHSC_02778 < S1084 < S1085 < S1086 < SAOUHSC_02781 < S1087
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
