From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02778
  • pan locus tag?: SAUPAN006056000
  • symbol: SAOUHSC_02778
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02778
  • symbol: SAOUHSC_02778
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2554408..2555103
  • length: 696
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACAGTATTAACAGATAAAGTAGCAGTAGTTACAGGTGCAGGTAGTGGTATTGGAGAA
    GCAATTGCAACATTACTACATGAAGAAGGGGCAAAAGTTGTCTTAGCAGGTAGAAATAAA
    GAAAAATTACAAAACGTAGCGAATCAATTGTCACAAGATAGTGTGAAGGTAGTGCCAACA
    GATGTAACGAATAAAGAAGAAGTCGATGAATTGATAAAAATTGCACAACAAACATTCGGT
    GGTTTGGATATTGTTATCAATAGTGCGGGGCAAATGTTGTCGTCTAAGATTACTGATTAT
    CAAGTAGATGAGTGGGATAGTATGATTGATGTGAATATCAAAGGCACTTTATATACGGCA
    CAGGCTGCATTACCAACTATGTTAGAACAATCAAGTGGCCATCTTATTAACATTGCATCT
    ATTTCTGGCTTTGAAGTAACGAAAAGTAGTACGATTTATAGTGCGACGAAAGCAGCAGTT
    CACACTATTACTCAAGGATTAGAAAAAGAGTTGGCAAAGACAGGCGTTAAAGTAACAAGC
    ATTTCTCCAGGAATGGTAGATACAGCCATAACTGCCGCATACAATCCAACAGATCGTAAA
    AAACTTGAACCACAAGATATTGCAGAAGCAGTATTATATGCATTAACACAACCAAAGCAC
    GTTAACGTGAATGAAATTACAGTGCGTCCTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    696

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02778
  • symbol: SAOUHSC_02778
  • description: hypothetical protein
  • length: 231
  • theoretical pI: 4.91397
  • theoretical MW: 24603.9
  • GRAVY: -0.0290043

Function[edit | edit source]

  • reaction:
    EC 1.-.-.-?  ExPASy
  • TIGRFAM:
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 155.3)
    Metabolism Energy metabolism Fermentation acetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 149.3)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 147.8)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 126.4)
    Unknown function Enzymes of unknown specificity SDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 125.5)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 124.7)
    and 18 more
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 123.5)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 119.2)
    Metabolism Energy metabolism Biosynthesis and degradation of polysaccharides 2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 117)
    Unknown function Enzymes of unknown specificity SDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 114.8)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 83.7)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis putative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 80)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 58.3)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 46.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 34.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin glutamyl-tRNA reductase (TIGR01035; EC 1.2.1.70; HMM-score: 21)
    Hypothetical proteins Conserved TIGR01777 family protein (TIGR01777; HMM-score: 20)
    Metabolism Amino acid biosynthesis Aromatic amino acid family shikimate dehydrogenase (TIGR00507; EC 1.1.1.25; HMM-score: 19.9)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 17.1)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein PilL, PFGI-1 class (TIGR03748; HMM-score: 16.4)
    Unknown function Enzymes of unknown specificity putative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 15.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides dTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 11.3)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS11 (TIGR03632; HMM-score: 11.1)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis hopanoid C-3 methylase HpnR (TIGR04367; HMM-score: 10.8)
  • TheSEED:  
    Oxidoreductase, short-chain dehydrogenase/reductase family
  • PFAM:
    NADP_Rossmann (CL0063) adh_short; short chain dehydrogenase (PF00106; HMM-score: 195.7)
    adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 163.9)
    and 25 more
    KR; KR domain (PF08659; HMM-score: 59.8)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 41.6)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 38.5)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 30.8)
    Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 26.6)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 24.6)
    3HCDH_N; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737; HMM-score: 23.4)
    NmrA; NmrA-like family (PF05368; HMM-score: 21.6)
    F420_oxidored; NADP oxidoreductase coenzyme F420-dependent (PF03807; HMM-score: 21.3)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 19.5)
    ApbA; Ketopantoate reductase PanE/ApbA (PF02558; HMM-score: 19.4)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 19.4)
    S11_L18p (CL0267) Ribosomal_S11; Ribosomal protein S11 (PF00411; HMM-score: 17.2)
    NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 17.1)
    no clan defined Arg_tRNA_synt_N; Arginyl tRNA synthetase N terminal domain (PF03485; HMM-score: 16.2)
    Asp23; Asp23 family, cell envelope-related function (PF03780; HMM-score: 14.8)
    NADP_Rossmann (CL0063) THF_DHG_CYH_C; Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882; HMM-score: 14.6)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 14.1)
    HUP (CL0039) ETF; Electron transfer flavoprotein domain (PF01012; HMM-score: 13.7)
    T3SS-hook (CL0424) Flg_hook; Flagellar hook-length control protein FliK (PF02120; HMM-score: 13.6)
    NADP_Rossmann (CL0063) DUF1776; Fungal family of unknown function (DUF1776) (PF08643; HMM-score: 13.6)
    RNase_H (CL0219) DDE_Tnp_1_3; Transposase DDE domain (PF13612; HMM-score: 13.4)
    no clan defined Nitro_FeMo-Co; Dinitrogenase iron-molybdenum cofactor (PF02579; HMM-score: 13.2)
    NADP_Rossmann (CL0063) IlvN; Acetohydroxy acid isomeroreductase, NADPH-binding domain (PF07991; HMM-score: 13)
    no clan defined Glyco_tran_WecB; Glycosyl transferase WecB/TagA/CpsF family (PF03808; HMM-score: 12)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009386
    • TAT(Tat/SPI): 0.001928
    • LIPO(Sec/SPII): 0.00181
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTVLTDKVAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDSVKVVPTDVTNKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEITVRPV

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAOUHSC_02778 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]