Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02832
- pan locus tag?: SAUPAN006176000
- symbol: SAOUHSC_02832
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02832
- symbol: SAOUHSC_02832
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2610420..2611055
- length: 636
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921271 NCBI
- RefSeq: YP_501291 NCBI
- BioCyc: G1I0R-2668 BioCyc
- MicrobesOnline: 1291262 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAACTAAATAACTATTCTTTAAAAGTTAAAAACAAACAACTAGTTGACAATTGTGAT
TTAAATTTCTATCTTGGTCAGATCAATCACATTGTTGGTAAAAATGGTGTAGGAAAATCT
TTATTAGCTAAAGATTTCTTACTAAATAATAGTGGAAATATCCCTAAGTCCATTTCTCAA
AATGTAACCTTAATATCAAGTTCATCAAATATTCCTAATGATATAACAAAAGATTTTTTA
TTATCATTGTTAAAATCAAAATTTGAAAACAATCGACAAACATTCGATAAGATTTATAAC
ATACTAAACATCGAAGCAATACCGTCTAACGTACTACTAAAAAACTTGAGTGATGGTCAA
AAACAAAAGCTTAAATTATTAAGTTTCTTATTGGAAGATCATGATTTAATCATATTAGAT
GAAGTTACAAACGCTTTAGACAAGAAAACAGTTAATGAAATTTATGAATTTTTAAATGAT
TTTATTCAAAGCCATCAAACTAAAACTATTATCAATATTACACATAATTTATCCGATTTA
AGTGCTTTGCCGGGTAAATACTTTATTTTTAAAGACCTTCAAATAGAAGAGTACCAATCA
AAAGAAGAAGTCATAAATGATTACATTAATTTATAA60
120
180
240
300
360
420
480
540
600
636
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02832
- symbol: SAOUHSC_02832
- description: hypothetical protein
- length: 211
- theoretical pI: 6.52286
- theoretical MW: 24107.4
- GRAVY: -0.269668
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 69.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 61.9)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 58.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 58.3)and 66 moreTransport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 51.7)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 46.8)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 46.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 46.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 45.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 44.5)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 44.5)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 44.2)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 44)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 43.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 43.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 42.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 42.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 41.7)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 41.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 41.3)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 41.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 40.5)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 40.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 39.9)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 38.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 38.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 38.3)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 38)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 37.9)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 37.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 37.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 37.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 37.1)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 36.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 36.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 35.1)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 34.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 34.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 34.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 33.8)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 33.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 33.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 33.1)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 32.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 32.4)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 32)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 30.9)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 30.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 28.6)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 26.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 26.7)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 26.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 26.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 25.2)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 25.2)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 25.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 24)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 24)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 23.8)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 23.8)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.4)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 20.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 20)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 19.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 15.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 12.4)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 10.4)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 10.4)
- TheSEED :
- ABC transporter, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 51.3)and 13 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 37.9)AAA_22; AAA domain (PF13401; HMM-score: 31.3)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 20.5)ATPase; KaiC (PF06745; HMM-score: 16.1)HTH (CL0123) Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 15.6)P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.3)NACHT; NACHT domain (PF05729; HMM-score: 15.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14)CobA_CobO_BtuR; ATP:corrinoid adenosyltransferase BtuR/CobO/CobP (PF02572; HMM-score: 13.8)RNA_helicase; RNA helicase (PF00910; HMM-score: 13.1)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13.1)AAA_23; AAA domain (PF13476; HMM-score: 9.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.043186
- TAT(Tat/SPI): 0.000318
- LIPO(Sec/SPII): 0.000919
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLNNYSLKVKNKQLVDNCDLNFYLGQINHIVGKNGVGKSLLAKDFLLNNSGNIPKSISQNVTLISSSSNIPNDITKDFLLSLLKSKFENNRQTFDKIYNILNIEAIPSNVLLKNLSDGQKQKLKLLSFLLEDHDLIILDEVTNALDKKTVNEIYEFLNDFIQSHQTKTIINITHNLSDLSALPGKYFIFKDLQIEEYQSKEEVINDYINL
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [3] : S1104 > SAOUHSC_02832 > SAOUHSC_02833
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)