From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 27-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP004 [new locus tag: SA_RS00015 ]
  • pan locus tag?:
  • symbol: SAP004
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAP004 [new locus tag: SA_RS00015 ]
  • symbol: SAP004
  • product: hypothetical protein
  • replicon: pN315
  • strand: +
  • coordinates: 3190..3384
  • length: 195
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATGAAAATTTAGAAAAATATATAAAAAGTTTGCCACTTTTAGGTTTGTTAATTAGT
    ATTTTGTTAATTGTTTTATTCTTTTTTATTTTAGATGTTGATGAAGATTTATTCGTGGTT
    TTTTTATACTGTTTATTGCCTTTGATAGTTAATTTGTCTATTTATGGTTTTTATGTTTTT
    GTTAAAAGAAAGTAA
    60
    120
    180
    195

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAP004 [new locus tag: SA_RS00015 ]
  • symbol: SAP004
  • description: hypothetical protein
  • length: 64
  • theoretical pI: 4.74269
  • theoretical MW: 7545.2
  • GRAVY: 1.28906

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    FIG01109938: hypothetical protein
  • PFAM:
    no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 10.8)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 10.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002109
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.012039
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNENLEKYIKSLPLLGLLISILLIVLFFFILDVDEDLFVVFLYCLLPLIVNLSIYGFYVFVKRK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAP004 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]