Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS00015 [old locus tag: SAP004 ]
- pan locus tag?:
- symbol: SA_RS00015
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS00015 [old locus tag: SAP004 ]
- symbol: SA_RS00015
- product: hypothetical protein
- replicon: pN315
- strand: +
- coordinates: 3190..3384
- length: 195
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATGAAAATTTAGAAAAATATATAAAAAGTTTGCCACTTTTAGGTTTGTTAATTAGT
ATTTTGTTAATTGTTTTATTCTTTTTTATTTTAGATGTTGATGAAGATTTATTCGTGGTT
TTTTTATACTGTTTATTGCCTTTGATAGTTAATTTGTCTATTTATGGTTTTTATGTTTTT
GTTAAAAGAAAGTAA60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS00015 [old locus tag: SAP004 ]
- symbol: SA_RS00015
- description: hypothetical protein
- length: 64
- theoretical pI: 4.74269
- theoretical MW: 7545.2
- GRAVY: 1.28906
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAP004
- PFAM: no clan defined DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 14.7)DUF5657; Family of unknown function (DUF5657) (PF18901; HMM-score: 14.6)and 2 moreDUF6814; Family of unknown function (DUF6814) (PF20664; HMM-score: 7.6)DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.989
- Cell wall & surface Score: 0
- Extracellular Score: 0.011
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002109
- TAT(Tat/SPI): 0.00015
- LIPO(Sec/SPII): 0.012039
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNENLEKYIKSLPLLGLLISILLIVLFFFILDVDEDLFVVFLYCLLPLIVNLSIYGFYVFVKRK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]