From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 27-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP005 [new locus tag: SA_RS00020 ]
  • pan locus tag?:
  • symbol: cadD
  • pan gene symbol?:
  • synonym:
  • product: protein CadD

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAP005 [new locus tag: SA_RS00020 ]
  • symbol: cadD
  • product: protein CadD
  • replicon: pN315
  • strand: +
  • coordinates: 4501..5118
  • length: 618
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATTCAAACGGTTGTTGCTGCTGCTGTTCTTTATATTGCTACAGCAGTTGATTTATTA
    GTAATTTTATTAATATTTTTTGCTAGAGCAAAGACTAGAAAAGAATATAGAGATATTTAT
    GTTGGTCAATATTTAGGGTCTATTATTTTAATATTAGTTAGTTTGTTTTTAGCTTTTGTA
    TTAAATTATGTTCCAGAAAAGTGGATATTAGGTTTATTGGGTTTAATACCAATTTATCTT
    GGAATTAAAGTGGCTATTTATGATGATTGTGAAGGAGAAAAGAGAGCTAAAAAAGAATTG
    AATGAAAAAGGATTGTCTAAATTAGTTGGTACGGTTGCAATTGTTACGATAGCAAGTTGT
    GGCGCCGATAATATTGGTTTATTTGTTCCGTATTTTGTGACATTAAGTGTTACTAATTTA
    TTACTTACTCTGTTTGTCTTTTTAATTTTAATTTTCTTCTTGGTGTTTACTGCACAAAAA
    TTAGCTAATATTCCAGGAATTGGAGAAATTGTTGAGAAATTTAGTCGTTGGATTATGGCT
    ATTATTTATATAGCTTTAGGTTTATTTATTATTATTGAAAATGACACTATTCAAACAATT
    TTAGGATTTATATTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    618

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAP005 [new locus tag: SA_RS00020 ]
  • symbol: CadD
  • description: protein CadD
  • length: 205
  • theoretical pI: 8.14825
  • theoretical MW: 22818.4
  • GRAVY: 1.12878

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines cadmium resistance transporter family protein (TIGR00779; HMM-score: 307.5)
    and 3 more
    Genetic information processing Protein fate Protein modification and repair cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 7.8)
    Metabolism Energy metabolism Electron transport cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 7.8)
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 4.4)
  • TheSEED:  
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Cadmium resistance  Cadmium resistance protein
  • PFAM:
    LysE (CL0292) Cad; Cadmium resistance transporter (PF03596; HMM-score: 302.2)
    and 5 more
    FumRed-TM (CL0335) Sdh_cyt; Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127; HMM-score: 10.5)
    no clan defined Virul_fac_BrkB; Virulence factor BrkB (PF03631; HMM-score: 9.7)
    DUF5366; Family of unknown function (DUF5366) (PF17328; HMM-score: 8.9)
    ExbD; Biopolymer transport protein ExbD/TolR (PF02472; HMM-score: 7.8)
    Bestrophin; Bestrophin, RFP-TM, chloride channel (PF01062; HMM-score: 5.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002458
    • TAT(Tat/SPI): 0.000255
    • LIPO(Sec/SPII): 0.027031
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIQTVVAAAVLYIATAVDLLVILLIFFARAKTRKEYRDIYVGQYLGSIILILVSLFLAFVLNYVPEKWILGLLGLIPIYLGIKVAIYDDCEGEKRAKKELNEKGLSKLVGTVAIVTIASCGADNIGLFVPYFVTLSVTNLLLTLFVFLILIFFLVFTAQKLANIPGIGEIVEKFSRWIMAIIYIALGLFIIIENDTIQTILGFIF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]