Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 27-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAP006 [new locus tag: SA_RS00025 ]
- pan locus tag?:
- symbol: cadX
- pan gene symbol?: —
- synonym:
- product: CadX
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAP006 [new locus tag: SA_RS00025 ]
- symbol: cadX
- product: CadX
- replicon: pN315
- strand: +
- coordinates: 5137..5484
- length: 348
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 1122767 NCBI
- RefSeq: NP_395542 NCBI
- BioCyc: see SA_RS00025
- MicrobesOnline: 143476 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGTTATGAAAATACTTGTGATGTGATCTGTGTACATGAGGATAAAGTTAACAATGCT
TTAAGTTTTTTAGAAGATGATAAATCTAAGAAATTACTTAACATTTTAGAAAAAATTTGT
GATGAGAAGAAATTGAAAATCATATTATCTTTGATTAAAGAAGATGAGTTGTGTGTTTGT
GATATTTCTTTGATATTGAAAATGAGTGTTGCTTCAACTTCACATCATTTAAGGCTTTTA
TATAAAAATGAGGTACTTGATTTTTATAAAGATGGAAAGATGGCATATTATTTTATTAAA
GACGATGAAATAAGAGAGTTTTTCTCTAAAAATCATGAGGGTTTTTGA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAP006 [new locus tag: SA_RS00025 ]
- symbol: CadX
- description: CadX
- length: 115
- theoretical pI: 5.251
- theoretical MW: 13517.6
- GRAVY: -0.231304
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 15.9)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 15.9)
- TheSEED :
- Cadmium efflux transcriptional regulatory protein CadC
- PFAM: HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 51.3)and 1 moreHTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001583
- TAT(Tat/SPI): 0.000066
- LIPO(Sec/SPII): 0.000679
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSYENTCDVICVHEDKVNNALSFLEDDKSKKLLNILEKICDEKKLKIILSLIKEDELCVCDISLILKMSVASTSHHLRLLYKNEVLDFYKDGKMAYYFIKDDEIREFFSKNHEGF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.