From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 27-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP009 [new locus tag: SA_RS00035 ]
  • pan locus tag?:
  • symbol: SAP009
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAP009 [new locus tag: SA_RS00035 ]
  • symbol: SAP009
  • product: hypothetical protein
  • replicon: pN315
  • strand: +
  • coordinates: 7000..7419
  • length: 420
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    GTGGAATTAGATAATTGTATAAATTATTTGTTGAGTACTTCTCAGAATAGAGTTTTTAAA
    CATTTTAAAAGTTTATTAAGTCCCTATAATATTACTCCAGCAGAATATGGTGTTTTGAAT
    TGCTTGATTAATAGTAATTTGAATACACCTAAAGCGATTGGTAATACTTTAAATTTAGAA
    CCTTCAACAATATCTGGAATATTAGATAAGATGTCCAAAAAGGATCTAATAACACGTCAA
    ACTGATAATGAAAATAGAAGAACTGTGCTAATAAACAGTACAAATAAAGCAAAAGACTTA
    TGGCCAACATTAGAAAAGAAAGCCTATCAACTTAATAATCATTACTTCGCTAATTTAACT
    AATGAAGAAACTGTAGTGTTTAAAAAGATATTACTAAAGATAAATAAAACTACGTTTTAA
    60
    120
    180
    240
    300
    360
    420

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAP009 [new locus tag: SA_RS00035 ]
  • symbol: SAP009
  • description: hypothetical protein
  • length: 139
  • theoretical pI: 9.83609
  • theoretical MW: 15938.2
  • GRAVY: -0.443165

Function[edit | edit source]

  • TIGRFAM:
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 35.8)
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 35.4)
    and 1 more
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 24.6)
  • TheSEED  :
    • Transcriptional regulator, MarR family
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 44.3)
    MarR_2; MarR family (PF12802; HMM-score: 37)
    and 14 more
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 33.2)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 30.7)
    HTH_micro; HTH-like (PF17007; HMM-score: 23.9)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 21.6)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 18)
    no clan defined DUF7675; Family of unknown function (DUF7675) (PF24723; HMM-score: 15)
    Swm2; Nucleolar protein Swm2 (PF17083; HMM-score: 14.3)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.2)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.7)
    PH0730-like_N; PH0730-like, N-terminal domain (PF22167; HMM-score: 13.5)
    Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 13.3)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 13.1)
    HTH_Cmi2_C; Cmi2, C-terminal (PF24270; HMM-score: 13.1)
    PTS_IIA-like (CL0742) DUF371; Domain of unknown function (DUF371) (PF04027; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9699
    • Cytoplasmic Membrane Score: 0.003
    • Cell wall & surface Score: 0.0009
    • Extracellular Score: 0.0262
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011275
    • TAT(Tat/SPI): 0.000275
    • LIPO(Sec/SPII): 0.000726
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MELDNCINYLLSTSQNRVFKHFKSLLSPYNITPAEYGVLNCLINSNLNTPKAIGNTLNLEPSTISGILDKMSKKDLITRQTDNENRRTVLINSTNKAKDLWPTLEKKAYQLNNHYFANLTNEETVVFKKILLKINKTTF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]