Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 27-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAP009 [new locus tag: SA_RS00035 ]
- pan locus tag?:
- symbol: SAP009
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAP009 [new locus tag: SA_RS00035 ]
- symbol: SAP009
- product: hypothetical protein
- replicon: pN315
- strand: +
- coordinates: 7000..7419
- length: 420
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 1122746 NCBI
- RefSeq: NP_395545 NCBI
- BioCyc: see SA_RS00035
- MicrobesOnline: 143479 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361GTGGAATTAGATAATTGTATAAATTATTTGTTGAGTACTTCTCAGAATAGAGTTTTTAAA
CATTTTAAAAGTTTATTAAGTCCCTATAATATTACTCCAGCAGAATATGGTGTTTTGAAT
TGCTTGATTAATAGTAATTTGAATACACCTAAAGCGATTGGTAATACTTTAAATTTAGAA
CCTTCAACAATATCTGGAATATTAGATAAGATGTCCAAAAAGGATCTAATAACACGTCAA
ACTGATAATGAAAATAGAAGAACTGTGCTAATAAACAGTACAAATAAAGCAAAAGACTTA
TGGCCAACATTAGAAAAGAAAGCCTATCAACTTAATAATCATTACTTCGCTAATTTAACT
AATGAAGAAACTGTAGTGTTTAAAAAGATATTACTAAAGATAAATAAAACTACGTTTTAA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAP009 [new locus tag: SA_RS00035 ]
- symbol: SAP009
- description: hypothetical protein
- length: 139
- theoretical pI: 9.83609
- theoretical MW: 15938.2
- GRAVY: -0.443165
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 35.8)homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 35.4)and 1 moreRegulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 24.6)
- TheSEED :
- Transcriptional regulator, MarR family
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 43.6)MarR_2; MarR family (PF12802; HMM-score: 38.1)and 7 moreHTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 30.2)HTH_micro; HTH-like (PF17007; HMM-score: 23.4)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 21.9)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.7)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 13.1)no clan defined DUF371; Domain of unknown function (DUF371) (PF04027; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011275
- TAT(Tat/SPI): 0.000275
- LIPO(Sec/SPII): 0.000726
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MELDNCINYLLSTSQNRVFKHFKSLLSPYNITPAEYGVLNCLINSNLNTPKAIGNTLNLEPSTISGILDKMSKKDLITRQTDNENRRTVLINSTNKAKDLWPTLEKKAYQLNNHYFANLTNEETVVFKKILLKINKTTF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]