From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 27-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAP016 [new locus tag: SA_RS00070 ]
  • pan locus tag?:
  • symbol: arsR
  • pan gene symbol?: —
  • synonym:
  • product: arsenical resistance operon repressor

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAP016 [new locus tag: SA_RS00070 ]
  • symbol: arsR
  • product: arsenical resistance operon repressor
  • replicon: pN315
  • strand: +
  • coordinates: 14107..14421
  • length: 315
  • essential: unknown

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCTTATAAAGAACTATCAACAATATTAAAAATTTTATCAGATCCAAGTAGGTTAGAA
    ATATTAGATTTACTTTCTTGTGGTGAGCTATGCGCTTGTGACTTATTAGAACACTTTCAA
    TTCTCACAACCTACACTAAGTCATCATATGAAGTCATTAGTAGATAATGAATTAGTTACA
    ACACGAAAAGATGGCAATAAACATTGGTATCAACTTAATCATGCTATTTTAGATGATATT
    ATCCAAAACTTGAACATCATTAATACATCTAATCAAAGATGTGTATGTAAAAATGTGAAA
    TCAGGTGACTGTTGA
    60
    120
    180
    240
    300
    315

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAP016 [new locus tag: SA_RS00070 ]
  • symbol: ArsR
  • description: arsenical resistance operon repressor
  • length: 104
  • theoretical pI: 6.3292
  • theoretical MW: 11873.6
  • GRAVY: -0.246154

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.9)
    Signal transduction Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.9)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 13.3)
    and 1 more
    Cellular processes Cellular processes Toxin production and resistance TOMM system kinase/cyclase fusion protein (TIGR03903; HMM-score: 10.1)
  • TheSEED  :
    • Arsenical resistance operon repressor
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Arsenic resistance  Arsenical resistance operon repressor
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 58)
    and 8 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 45)
    MarR_2; MarR family (PF12802; HMM-score: 18.9)
    F-box (CL0271) F-box; F-box domain (PF00646; HMM-score: 16.1)
    HTH (CL0123) TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 15.7)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 15.5)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 14.1)
    RP-C; Replication protein C N-terminal domain (PF03428; HMM-score: 13.7)
    MarR; MarR family (PF01047; HMM-score: 13.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors: Arsenate; Arsenite
  • genes regulated by ArsR, TF important in Arsenic resistanceRegPrecise
    repression
    arsR > arsB > arsC

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.024844
    • TAT(Tat/SPI): 0.002066
    • LIPO(Sec/SPII): 0.084443
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSYKELSTILKILSDPSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKDGNKHWYQLNHAILDDIIQNLNIINTSNQRCVCKNVKSGDC

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: ArsR (repression) regulon
    ArsR(TF)important in Arsenic resistance; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAP016&oldid=82494"