Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS00070 [old locus tag: SAP016 ]
- pan locus tag?:
- symbol: SA_RS00070
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS00070 [old locus tag: SAP016 ]
- symbol: SA_RS00070
- product: transcriptional regulator
- replicon: pN315
- strand: +
- coordinates: 14107..14421
- length: 315
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCTTATAAAGAACTATCAACAATATTAAAAATTTTATCAGATCCAAGTAGGTTAGAA
ATATTAGATTTACTTTCTTGTGGTGAGCTATGCGCTTGTGACTTATTAGAACACTTTCAA
TTCTCACAACCTACACTAAGTCATCATATGAAGTCATTAGTAGATAATGAATTAGTTACA
ACACGAAAAGATGGCAATAAACATTGGTATCAACTTAATCATGCTATTTTAGATGATATT
ATCCAAAACTTGAACATCATTAATACATCTAATCAAAGATGTGTATGTAAAAATGTGAAA
TCAGGTGACTGTTGA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS00070 [old locus tag: SAP016 ]
- symbol: SA_RS00070
- description: transcriptional regulator
- length: 104
- theoretical pI: 6.3292
- theoretical MW: 11873.6
- GRAVY: -0.246154
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.9)Regulatory functions DNA interactions copper transport repressor, CopY/TcrY family (TIGR02698; HMM-score: 14.9)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 13.3)and 1 moreCellular processes Toxin production and resistance TOMM system kinase/cyclase fusion protein (TIGR03903; HMM-score: 10.1)
- TheSEED: see SAP016
- PFAM: HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 56.5)and 10 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 32.4)Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 16.6)F-box (CL0271) F-box; F-box domain (PF00646; HMM-score: 16.3)HTH (CL0123) TFIIE_alpha; TFIIE alpha subunit (PF02002; HMM-score: 15.8)MarR_2; MarR family (PF12802; HMM-score: 14.8)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.6)MarR; MarR family (PF01047; HMM-score: 13.9)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.7)RP-C; Replication protein C N-terminal domain (PF03428; HMM-score: 12.5)DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by ArsR, TF important in Arsenic resistance: see SAP016
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.996
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0034
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.024844
- TAT(Tat/SPI): 0.002066
- LIPO(Sec/SPII): 0.084443
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSYKELSTILKILSDPSRLEILDLLSCGELCACDLLEHFQFSQPTLSHHMKSLVDNELVTTRKDGNKHWYQLNHAILDDIIQNLNIINTSNQRCVCKNVKSGDC
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: ArsR see SAP016
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]