Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 27-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAP021 [new locus tag: SA_RS00095 ]
- pan locus tag?:
- symbol: SAP021
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAP021 [new locus tag: SA_RS00095 ]
- symbol: SAP021
- product: hypothetical protein
- replicon: pN315
- strand: +
- coordinates: 18809..19120
- length: 312
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 1122749 NCBI
- RefSeq: NP_395557 NCBI
- BioCyc:
- MicrobesOnline: 143491 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAGAACTTTAATTATTGTAACAATTGTACTATTAATCATCATACTTAGTCTGTTA
TTGGTTAGAAATGAGCATTTAGATCGTTTTAACCCACTGTTAAAAGAAAAAGTATCTTAT
GCCAAAGTTCCAAAAGATACCCAGGACTATAGAAATATAACTGTATACTCTAAAAATGGA
GAAAAAAAGAGTTATAAATTGGATTTTTTAGGTTATGATCCTACAAAAGAATATGTGAAA
GTAAATCATAAAGGGAAATATGTGCGTTCGATAGAATACATTACAAAAGATATTCCTAGC
TTTTTAAAATGA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAP021 [new locus tag: SA_RS00095 ]
- symbol: SAP021
- description: hypothetical protein
- length: 103
- theoretical pI: 10.2512
- theoretical MW: 12163.3
- GRAVY: -0.287379
⊟Function[edit | edit source]
- TIGRFAM: Hypothetical proteins Conserved conserved hypothetical protein (TIGR01655; HMM-score: 62.6)
- TheSEED :
- FIG01109643: hypothetical protein
- PFAM: no clan defined Tmemb_9; TMEM9 (PF05434; HMM-score: 13.7)and 1 moreAsmA-like (CL0401) AsmA; AsmA family (PF05170; HMM-score: 9.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.317444
- TAT(Tat/SPI): 0.000917
- LIPO(Sec/SPII): 0.087709
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRTLIIVTIVLLIIILSLLLVRNEHLDRFNPLLKEKVSYAKVPKDTQDYRNITVYSKNGEKKSYKLDFLGYDPTKEYVKVNHKGKYVRSIEYITKDIPSFLK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]