Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS062 [new locus tag: SA_RS10240 ]
- pan locus tag?: SAUPAN005082000
- symbol: SAS062
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS062 [new locus tag: SA_RS10240 ]
- symbol: SAS062
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2032977..2033126
- length: 150
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124671 NCBI
- RefSeq: NP_375080 NCBI
- BioCyc: see SA_RS10240
- MicrobesOnline: 104106 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATTAAGCAAATACTAAGATTATTATTCTTACTAGCAATGTACGAGTTAGGTAAGTAT
GTAACTGAGCAAGTATATATTATGATGACAGCTAATGATGATGTAGAGGCGCCGAGTGAT
TACGTCTTTCGAGCGGAGGTAAGTGAGTGA60
120
150
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS062 [new locus tag: SA_RS10240 ]
- symbol: SAS062
- description: hypothetical protein
- length: 49
- theoretical pI: 4.07995
- theoretical MW: 5748.7
- GRAVY: 0.24898
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0129
- Cytoplasmic Membrane Score: 0.9361
- Cell wall & surface Score: 0
- Extracellular Score: 0.051
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 0.83
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.145512
- TAT(Tat/SPI): 0.002227
- LIPO(Sec/SPII): 0.019447
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYVFRAEVSE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1781 < SAS062 < SA1782 < SA1783
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.