Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS068 [new locus tag: SA_RS10865 ]
- pan locus tag?: SAUPAN005361000
- symbol: SAS068
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS068 [new locus tag: SA_RS10865 ]
- symbol: SAS068
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2142166..2142303
- length: 138
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124789 NCBI
- RefSeq: NP_375193 NCBI
- BioCyc: see SA_RS10865
- MicrobesOnline: 104219 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAACGTCCTGAAAAGATTCAAAATGTAGTCAAACTATTGTCATCATTAGGTGTGAAT
ATTAAAAAAACTAAATCTCGTTTAGACATTATTAATACTTTGCCAGCATCTAATAAAGTA
AGTCACGAATTAAAATAA60
120
138
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS068 [new locus tag: SA_RS10865 ]
- symbol: SAS068
- description: hypothetical protein
- length: 45
- theoretical pI: 11.2476
- theoretical MW: 5070.04
- GRAVY: -0.424444
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.084057
- TAT(Tat/SPI): 0.006317
- LIPO(Sec/SPII): 0.011648
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRPEKIQNVVKLLSSLGVNIKKTKSRLDIINTLPASNKVSHELK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.