From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN005042000
  • symbol?:
  • description?: phiPVL ORF17-like protein

      descriptions from strain specific annotations:

    • phiPVL ORF17-like protein
    • hypothetcal bacteriophage protein
    • DUF2951 domain-containing protein
    • phage protein
    • phi PVL ORF17 family protein
    • putative phage membrane protein
  • strand?: -
  • coordinates?: 5204452..5205009
  • synteny block?: BlockID0039200
  • occurrence?: in 33% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    6850:
    RSAU_000614
    71193:
    ST398NM01_0394
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18650
    JH1:
    SaurJH1_2041
    JH9:
    SaurJH9_2005
    JKD6008:
    JKD6159:
    SAA6159_01879
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_17900
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11191
    TW20:
    USA300_TCH1516:
    USA300HOU_1954
    VC40:

Genome Viewer[edit | edit source]

NCTC8325
USA300_FPR3757

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    NCTC8325        MGWFKKHEHEWRIRRLEENDKTMLSTLNEIKLGQKTQEQVNIKLDKTLDAIQKEREIDEK
    USA300_FPR3757  MGWFKKHEHEWRIRRLEENDKTMLSTLNEIKLGQKTQEQVNIKLDKTLDAIQKEREIDEK
                    ************************************************************

    NCTC8325        NKKENDKNIRDMKMWVLGLVGTIFGSLIIALLRMLMGI
    USA300_FPR3757  NKKENDKNIRDMKMWVLGLVGTIFGSLIIALLRMLMGI
                    **************************************