From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1925 [new locus tag: SAUSA300_RS10565 ]
  • pan locus tag?: SAUPAN005042000
  • symbol: SAUSA300_1925
  • pan gene symbol?:
  • synonym:
  • product: phiPVL ORF17-like protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1925 [new locus tag: SAUSA300_RS10565 ]
  • symbol: SAUSA300_1925
  • product: phiPVL ORF17-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2090666..2090962
  • length: 297
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGGGGTGGTTCAAAAAACACGAACATGAATGGCGCATCAGAAGGTTAGAAGAGAATGAT
    AAAACAATGCTCAGCACACTCAATGAAATTAAATTAGGTCAAAAAACCCAAGAGCAAGTT
    AACATTAAATTAGATAAAACCTTAGATGCTATTCAAAAAGAAAGAGAAATAGATGAAAAG
    AATAAGAAAGAAAATGATAAGAACATACGTGATATGAAAATGTGGGTGCTTGGTTTAGTT
    GGGACAATATTTGGATCGCTAATTATAGCATTATTGCGTATGCTTATGGGCATATAA
    60
    120
    180
    240
    297

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1925 [new locus tag: SAUSA300_RS10565 ]
  • symbol: SAUSA300_1925
  • description: phiPVL ORF17-like protein
  • length: 98
  • theoretical pI: 10.0627
  • theoretical MW: 11665.7
  • GRAVY: -0.627551

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AB (TIGR02833; HMM-score: 16.1)
  • TheSEED  :
    • Phage phi 11 orf48 protein homolog
  • PFAM:
    no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 185.3)
    and 5 more
    ClpP_crotonase (CL0127) Peptidase_S49_N; Peptidase family S49 N-terminal (PF08496; HMM-score: 15.2)
    no clan defined BicD; Microtubule-associated protein Bicaudal-D (PF09730; HMM-score: 14.3)
    RAMP4; Ribosome associated membrane protein RAMP4 (PF06624; HMM-score: 12.4)
    DUF1191; Protein of unknown function (DUF1191) (PF06697; HMM-score: 11.7)
    XhlA; Haemolysin XhlA (PF10779; HMM-score: 9.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: Intracellular /TMH start AFTER 60
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: Possibly Sec-
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002711
    • TAT(Tat/SPI): 0.000267
    • LIPO(Sec/SPII): 0.00069
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGWFKKHEHEWRIRRLEENDKTMLSTLNEIKLGQKTQEQVNIKLDKTLDAIQKEREIDEKNKKENDKNIRDMKMWVLGLVGTIFGSLIIALLRMLMGI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]