Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS10565 [old locus tag: SAUSA300_1925 ]
- pan locus tag?: SAUPAN005042000
- symbol: SAUSA300_RS10565
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS10565 [old locus tag: SAUSA300_1925 ]
- symbol: SAUSA300_RS10565
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2090666..2090962
- length: 297
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2090666..2090962) NCBI
- BioCyc: SAUSA300_RS10565 BioCyc
- MicrobesOnline: see SAUSA300_1925
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGGGGTGGTTCAAAAAACACGAACATGAATGGCGCATCAGAAGGTTAGAAGAGAATGAT
AAAACAATGCTCAGCACACTCAATGAAATTAAATTAGGTCAAAAAACCCAAGAGCAAGTT
AACATTAAATTAGATAAAACCTTAGATGCTATTCAAAAAGAAAGAGAAATAGATGAAAAG
AATAAGAAAGAAAATGATAAGAACATACGTGATATGAAAATGTGGGTGCTTGGTTTAGTT
GGGACAATATTTGGATCGCTAATTATAGCATTATTGCGTATGCTTATGGGCATATAA60
120
180
240
297
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS10565 [old locus tag: SAUSA300_1925 ]
- symbol: SAUSA300_RS10565
- description: hypothetical protein
- length: 98
- theoretical pI: 10.0627
- theoretical MW: 11665.7
- GRAVY: -0.627551
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination stage III sporulation protein AB (TIGR02833; HMM-score: 16.1)
- TheSEED: see SAUSA300_1925
- PFAM: no clan defined DUF2951; Protein of unknown function (DUF2951) (PF11166; HMM-score: 185.3)and 3 moreDUF6118; Family of unknown function (DUF6118) (PF19613; HMM-score: 14.9)DUF6040; Family of unknown function (DUF6040) (PF19506; HMM-score: 13)XhlA; Haemolysin XhlA (PF10779; HMM-score: 9.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0083
- Cytoplasmic Membrane Score: 0.9194
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.0715
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002711
- TAT(Tat/SPI): 0.000267
- LIPO(Sec/SPII): 0.00069
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI: 446461834 NCBI
- RefSeq: WP_000539688 NCBI
- UniProt: see SAUSA300_1925
⊟Protein sequence[edit | edit source]
- MGWFKKHEHEWRIRRLEENDKTMLSTLNEIKLGQKTQEQVNIKLDKTLDAIQKEREIDEKNKKENDKNIRDMKMWVLGLVGTIFGSLIIALLRMLMGI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]