From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN005350000
  • symbol?: kdpF
  • description?: K+-transporting ATPase, F subunit

      descriptions from strain specific annotations:

    • K+-transporting ATPase, F subunit
    • potassium-transporting ATPase subunit F
    • K+-transporting ATPase, F subunit, putative
    • K+-transporting ATPase subunit F
  • strand?: -
  • coordinates?: 5524523..5524678
  • synteny block?: BlockID0041470
  • occurrence?: in 21% of 33 strains

Orthologs[edit | edit source]

    COL:
    SACOL2069 (kdpF)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    6850:
    71193:
    ST398NM01_2119
    ECT-R 2:
    ED133:
    ED98:
    SAAV_2132 (kdpF)
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    SAPIG2119
    T0131:
    TCH60:
    HMPREF0772_11117 (kdpF)
    TW20:
    USA300_TCH1516:
    USA300HOU_2073
    VC40:

Genome Viewer[edit | edit source]

COL
NCTC8325

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    COL             MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF
    NCTC8325        MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF
                    ************************************