Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2069 [new locus tag: SACOL_RS10825 ]
- pan locus tag?: SAUPAN005350000
- symbol: kdpF
- pan gene symbol?: kdpF
- synonym:
- product: K+-transporting ATPase, F subunit
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2069 [new locus tag: SACOL_RS10825 ]
- symbol: kdpF
- product: K+-transporting ATPase, F subunit
- replicon: chromosome
- strand: -
- coordinates: 2133474..2133584
- length: 111
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238085 NCBI
- RefSeq: YP_186885 NCBI
- BioCyc: see SACOL_RS10825
- MicrobesOnline: 913546 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61ATGTTGTTGTGTTGTAAGGAGGTTATGGCAATGCTCATCGTTTTATTACTGGTAGTTATT
GCATTAGTTTTGTATTTATTTTATGCCTTAATTCGTAGTGAAAAATTTTAG60
111
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2069 [new locus tag: SACOL_RS10825 ]
- symbol: KdpF
- description: K+-transporting ATPase, F subunit
- length: 36
- theoretical pI: 8.21128
- theoretical MW: 4176.38
- GRAVY: 1.98611
⊟Function[edit | edit source]
- reaction: EC 3.6.3.12? ExPASyPotassium-transporting ATPase ATP + H2O + K+(Out) = ADP + phosphate + K+(In)
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds K+-transporting ATPase, F subunit (TIGR02115; EC 3.6.3.12; HMM-score: 31.4)
- TheSEED:
- PFAM: no clan defined Potass_KdpF; F subunit of K+-transporting ATPase (Potass_KdpF) (PF09604; HMM-score: 36.8)and 2 moreFeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 13.7)TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0015
- Cytoplasmic Membrane Score: 0.9968
- Cell wall & surface Score: 0
- Extracellular Score: 0.0016
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009297
- TAT(Tat/SPI): 0.000697
- LIPO(Sec/SPII): 0.023663
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]