From AureoWiki
(Redirected from JSNZ 002039)
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002039 [new locus tag: EGJ38_RS10180 ]
  • pan locus tag?: SAUPAN005350000
  • symbol: kdpF
  • pan gene symbol?: kdpF
  • synonym:
  • alternate name: JSNZ_002039
  • product: K(+)-transporting ATPase subunit F

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002039 [new locus tag: EGJ38_RS10180 ]
  • symbol: kdpF
  • product: K(+)-transporting ATPase subunit F
  • replicon: chromosome
  • strand: -
  • coordinates: 2053778..2053888
  • length: 111
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423940 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    ATGTTGTTGTGTTGTAAGGAGGTTATGGCAATGCTCATCGTTTTATTACTGGTAGTTATT
    GCATTAGTTTTGTATTTATTTTATGCCTTAATTCGTAGTGAAAAATTTTAG
    60
    111


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002039 [new locus tag: EGJ38_RS10180 ]
  • symbol: KdpF
  • description: K(+)-transporting ATPase subunit F
  • length: 36
  • theoretical pI: 8.21128
  • theoretical MW: 4176.38
  • GRAVY: 1.98611

Function[edit | edit source]

  • reaction:
    EC 7.2.2.6?  ExPASy
    non-specified enzyme name
  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds K+-transporting ATPase, F subunit (TIGR02115; EC 3.6.3.12; HMM-score: 31.4)
  • TheSEED:
  • PFAM:
    no clan defined Potass_KdpF; F subunit of K+-transporting ATPase (Potass_KdpF) (PF09604; HMM-score: 36.8)
    and 2 more
    FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 13.7)
    TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 11.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0015
    • Cytoplasmic Membrane Score: 0.9968
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0016
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009297
    • TAT(Tat/SPI): 0.000697
    • LIPO(Sec/SPII): 0.023663
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423940 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]