PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus COL
• locus tag: SACOL_RS10825 [old locus tag: SACOL2069 ]
• pan locus tag^?: SAUPAN005350000
• symbol: SACOL_RS10825
• pan gene symbol^?: kdpF
• synonym:
• product: potassium-transporting ATPase subunit F

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SACOL_RS10825 [old locus tag: SACOL2069 ]
• symbol: SACOL_RS10825
• product: potassium-transporting ATPase subunit F
• replicon: chromosome
• strand: -
• coordinates: 2133474..2133584
• length: 111
• essential: unknown other strains

⊟Accession numbers

• Location: NC_002951 (2133474..2133584) NCBI
• BioCyc: SACOL_RS10825 BioCyc
• MicrobesOnline: see SACOL2069

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  
  ATGTTGTTGTGTTGTAAGGAGGTTATGGCAATGCTCATCGTTTTATTACTGGTAGTTATT
  GCATTAGTTTTGTATTTATTTTATGCCTTAATTCGTAGTGAAAAATTTTAG
  60
  111
  

⊟Protein

⊟General

• locus tag: SACOL_RS10825 [old locus tag: SACOL2069 ]
• symbol: SACOL_RS10825
• description: potassium-transporting ATPase subunit F
• length: 36
• theoretical pI: 8.21128
• theoretical MW: 4176.38
• GRAVY: 1.98611

⊟Function

• reaction:
  EC 3.6.3.12?  ExPASy
  Potassium-transporting ATPase ATP + H₂O + K⁺(Out) = ADP + phosphate + K⁺(In)
• TIGRFAM:
  Metabolism Transport and binding proteins Cations and iron carrying compounds K+-transporting ATPase, F subunit (TIGR02115; EC 3.6.3.12; HMM-score: 31.4)
• TheSEED:
• PFAM:
  no clan defined Potass_KdpF; F subunit of K+-transporting ATPase (Potass_KdpF) (PF09604; HMM-score: 35.3)
  and 3 more
  P12; Virus attachment protein p12 family (PF12669; HMM-score: 16.2)
  FixQ; Cbb3-type cytochrome oxidase component FixQ (PF05545; HMM-score: 12.9)
  TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 11.1)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.32
  • Cytoplasmic Membrane Score: 9.55
  • Cellwall Score: 0.12
  • Extracellular Score: 0.01
  • Internal Helix: 1
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.009297
  • TAT(Tat/SPI): 0.000697
  • LIPO(Sec/SPII): 0.023663
• predicted transmembrane helices (TMHMM): 1

⊟Accession numbers

• GI: 487705409 NCBI
• RefSeq: WP_001789641 NCBI
• UniProt: see SACOL2069

⊟Protein sequence

• MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications