From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS10825 [old locus tag: SACOL2069 ]
  • pan locus tag?: SAUPAN005350000
  • symbol: SACOL_RS10825
  • pan gene symbol?: kdpF
  • synonym:
  • product: potassium-transporting ATPase subunit F

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS10825 [old locus tag: SACOL2069 ]
  • symbol: SACOL_RS10825
  • product: potassium-transporting ATPase subunit F
  • replicon: chromosome
  • strand: -
  • coordinates: 2133474..2133584
  • length: 111
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (2133474..2133584) NCBI
  • BioCyc: G1G4B-2275 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    ATGTTGTTGTGTTGTAAGGAGGTTATGGCAATGCTCATCGTTTTATTACTGGTAGTTATT
    GCATTAGTTTTGTATTTATTTTATGCCTTAATTCGTAGTGAAAAATTTTAG
    60
    111

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS10825 [old locus tag: SACOL2069 ]
  • symbol: SACOL_RS10825
  • description: potassium-transporting ATPase subunit F
  • length: 36
  • theoretical pI: 8.21128
  • theoretical MW: 4176.38
  • GRAVY: 1.98611

Function[edit | edit source]

  • reaction:
    EC 3.6.3.12?  ExPASy
    Potassium-transporting ATPase ATP + H2O + K+(Out) = ADP + phosphate + K+(In)
  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds K+-transporting ATPase, F subunit (TIGR02115; EC 3.6.3.12; HMM-score: 31.4)
  • TheSEED:
  • PFAM:
    no clan defined Potass_KdpF; F subunit of K+-transporting ATPase (Potass_KdpF) (PF09604; HMM-score: 35.3)
    and 3 more
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 16.2)
    FixQ; Cbb3-type cytochrome oxidase component FixQ (PF05545; HMM-score: 12.9)
    TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 11.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009297
    • TAT(Tat/SPI): 0.000697
    • LIPO(Sec/SPII): 0.023663
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 487705409 NCBI
  • RefSeq: WP_001789641 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLLCCKEVMAMLIVLLLVVIALVLYLFYALIRSEKF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]