From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN006315000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 6360200..6360295
  • synteny block?: BlockID0050310
  • occurrence?: in 15% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2673
    11819-97:
    6850:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    SAAV_2679
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_2607
    VC40:

Genome Viewer[edit | edit source]

COL
NCTC8325

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    COL             MKNVSIYKTTQELSFVSSLDFYLTKHLTLML
    NCTC8325        MKNVSIYKTTQELSFVSSLDFYLTKHLTLML
                    *******************************