Jump to navigation
Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0035 [new locus tag: SAUSA300_RS00175 ]
- pan locus tag?: SAUPAN000103000
- symbol: SAUSA300_0035
- pan gene symbol?: rplL
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0035 [new locus tag: SAUSA300_RS00175 ]
- symbol: SAUSA300_0035
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 42236..42451
- length: 216
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3914509 NCBI
- RefSeq: YP_492754 NCBI
- BioCyc: GH3C-34 BioCyc
- MicrobesOnline: 1291549 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGGGCGATAAAGAGTTAAGAGCCATTGCACATGAGTTAACTAAAACAGTTAAGGATAAC
ATGAGTGTTGATTGGTCTAAACGAGACAGTGCTAAAGCTAAAATGAGAGTTCAAGTTAGA
CGCCTATTAAAGAAATATGGCTATCCACCAGATCTTCAAAAAATGGCTGTGGAACAAGTT
GTAGAGCAAGCAGAATTAATGGCAAGTCAGCAATAA60
120
180
216
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0035 [new locus tag: SAUSA300_RS00175 ]
- symbol: SAUSA300_0035
- description: hypothetical protein
- length: 71
- theoretical pI: 10.2169
- theoretical MW: 8204.52
- GRAVY: -0.75493
⊟Function[edit | edit source]
- TIGRFAM: 2-aminoethylphosphonate aminotransferase (TIGR03301; EC 2.6.1.-; HMM-score: 12.2)
- TheSEED: DNA Metabolism DNA Metabolism - no subcategory Restriction-Modification System Type I restriction-modification system, restriction subunit R (EC 3.1.21.3)and 1 more
- PFAM: no clan defined DUF3387; Domain of unknown function (DUF3387) (PF11867; HMM-score: 101.2)and 1 moreDnaB_2; Replication initiation and membrane attachment (PF07261; HMM-score: 14.4)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004594
- TAT(Tat/SPI): 0.000817
- LIPO(Sec/SPII): 0.000444
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGDKELRAIAHELTKTVKDNMSVDWSKRDSAKAKMRVQVRRLLKKYGYPPDLQKMAVEQVVEQAELMASQQ
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]