From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0055 [new locus tag: SAUSA300_RS00280 ]
  • pan locus tag?: SAUPAN000809000
  • symbol: SAUSA300_0055
  • pan gene symbol?: adhC
  • synonym:
  • product: alcohol dehydrogenase, zinc-containing

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0055 [new locus tag: SAUSA300_RS00280 ]
  • symbol: SAUSA300_0055
  • product: alcohol dehydrogenase, zinc-containing
  • replicon: chromosome
  • strand: +
  • coordinates: 64125..65222
  • length: 1098
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGGGGGCTAAAAAGCCCTATAAAGAATCTAAACCTTTAAAAATTGAATACTTAGAACTT
    GATAATCCTAGCGAACACGAAGTATTAATTAAAATTCATGCAGCTGGATTATGTCACTCT
    GATTTGTCAGTAATTAATGGTAACAGACCTAGACCTTTACCTATGGCACTTGGTCATGAA
    GCTTCCGGTGAAGTAATTAAAGTTGGAAAAGCTGTTACAAGAGTTAGCGAAGGAGATCAT
    GTGGTATGCACATTTATTCCCAGTTGTGGAAAATGTATCCCATGTAAAGAAGGACGTCCT
    GCATTATGTGAAAACGGAGCAATATCTAATGAAAAAGGCGAAATGTTAGAGGGAGGGATG
    CGTTTATCTAATGATGAAGGAAAAGTATATCATCACTTGGGGATATCAGGTTTTGCTGAA
    TATTCTGTTGTCTCTGAAAACTCTATAGTTAAAATTGATAAAAAAATACCTTTTGAACGT
    GCAGCTGCATTTGGTTGTGCTATTATCACAGGTATCGGTGCTGTGGTGAATACAGCCCAA
    ATTCGTTCTGGTAGTAATGTAGCGGTTGTTGGTTTAGGAGGTATTGGATTGAATGCTATT
    ATTGGAGCTAAACTAGCGGGAGCCAATGAAATTATTGCTTTAGATATTAACGAAGATAAA
    TTTGAATTAGCAAAGCAATTTGGGGCTACAGCAACATTTAATTCAAGCGATAAAGATATC
    GATGAGCAAATTAAAGAATATATTCCTGGCGGAGTAGAATATGCTTTTGAAACAGCGGGT
    GTAGTGCCAGCTATGAAAGTTGCTTATCAGATTACTAAACGAGGGGGGACAACTGTAACA
    ACAGGACTGCCTAATCCTAAAGATAATTTTTCTTTCCCTCAAGTTACTTTAGCGGCTGAA
    GAACGTACCATTAAAGGATCATATGTAGGAAGTTGTGTACCTGACAGAGATATACCAAGG
    TTCGTTAATCTATACAACCAAGGACGTTTAAATATTGATTCACTCATCAGTGAGGTTATC
    ACTTTAGATGAAATTAATGAGGGATTTGATCGTTTGTCTAATGGTGAAGTAGGTAGAATT
    ATAATGAAGATGCATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1098

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0055 [new locus tag: SAUSA300_RS00280 ]
  • symbol: SAUSA300_0055
  • description: alcohol dehydrogenase, zinc-containing
  • length: 365
  • theoretical pI: 5.90054
  • theoretical MW: 39116.5
  • GRAVY: -0.106301

Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity NDMA-dependent alcohol dehydrogenase, Rxyl_3153 family (TIGR03989; EC 1.1.99.36; HMM-score: 329.9)
    Cellular processes Cellular processes Detoxification S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (TIGR02818; EC 1.1.1.1,1.1.1.284; HMM-score: 306.2)
    Metabolism Energy metabolism Fermentation S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (TIGR02818; EC 1.1.1.1,1.1.1.284; HMM-score: 306.2)
    Cellular processes Cellular processes Detoxification S-(hydroxymethyl)mycothiol dehydrogenase (TIGR03451; EC 1.1.1.306; HMM-score: 285.6)
    and 10 more
    Metabolism Energy metabolism Amino acids and amines L-threonine 3-dehydrogenase (TIGR00692; EC 1.1.1.103; HMM-score: 142.7)
    putative phosphonate catabolism associated alcohol dehydrogenase (TIGR03366; HMM-score: 134.4)
    6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 123.8)
    Unknown function Enzymes of unknown specificity putative NAD(P)H quinone oxidoreductase, PIG3 family (TIGR02824; HMM-score: 89.4)
    Metabolism Central intermediary metabolism One-carbon metabolism formaldehyde dehydrogenase, glutathione-independent (TIGR02819; EC 1.2.1.46; HMM-score: 86.8)
    Metabolism Energy metabolism Fermentation zinc-binding alcohol dehydrogenase family protein (TIGR02822; EC 1.-.-.-; HMM-score: 61)
    crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 58)
    Unknown function Enzymes of unknown specificity putative quinone oxidoreductase, YhdH/YhfP family (TIGR02823; HMM-score: 35.3)
    Metabolism Energy metabolism Fermentation zinc-binding alcohol dehydrogenase family protein (TIGR02817; HMM-score: 28.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll chlorophyll synthesis pathway protein BchC (TIGR01202; HMM-score: 23.8)
  • TheSEED:  
    Carbohydrates Fermentation Fermentations: Lactate  Alcohol dehydrogenase (EC 1.1.1.1)
    and 2 more
    Fermentations: Mixed acid  Alcohol dehydrogenase (EC 1.1.1.1)
    Fatty Acids, Lipids, and Isoprenoids Phospholipids Glycerolipid and Glycerophospholipid Metabolism in Bacteria  Alcohol dehydrogenase (EC 1.1.1.1)
  • PFAM:
    NADP_Rossmann (CL0063) ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 102.8)
    GroES (CL0296) ADH_N; Alcohol dehydrogenase GroES-like domain (PF08240; HMM-score: 101)
    and 5 more
    NADP_Rossmann (CL0063) AlaDh_PNT_C; Alanine dehydrogenase/PNT, C-terminal domain (PF01262; HMM-score: 21.1)
    Glu_dehyd_C; Glucose dehydrogenase C-terminus (PF16912; HMM-score: 19.5)
    ADH_zinc_N_2; Zinc-binding dehydrogenase (PF13602; HMM-score: 18.3)
    no clan defined NADH_4Fe-4S; NADH-ubiquinone oxidoreductase-F iron-sulfur binding region (PF10589; HMM-score: 15.3)
    NADP_Rossmann (CL0063) UDPG_MGDP_dh_N; UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain (PF03721; HMM-score: 12.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 2
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.016638
    • TAT(Tat/SPI): 0.004386
    • LIPO(Sec/SPII): 0.000745
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGAKKPYKESKPLKIEYLELDNPSEHEVLIKIHAAGLCHSDLSVINGNRPRPLPMALGHEASGEVIKVGKAVTRVSEGDHVVCTFIPSCGKCIPCKEGRPALCENGAISNEKGEMLEGGMRLSNDEGKVYHHLGISGFAEYSVVSENSIVKIDKKIPFERAAAFGCAIITGIGAVVNTAQIRSGSNVAVVGLGGIGLNAIIGAKLAGANEIIALDINEDKFELAKQFGATATFNSSDKDIDEQIKEYIPGGVEYAFETAGVVPAMKVAYQITKRGGTTVTTGLPNPKDNFSFPQVTLAAEERTIKGSYVGSCVPDRDIPRFVNLYNQGRLNIDSLISEVITLDEINEGFDRLSNGEVGRIIMKMH

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAUSA300_0055 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]