From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0136 [new locus tag: SAUSA300_RS00710 ]
  • pan locus tag?: SAUPAN000943000
  • symbol: SAUSA300_0136
  • pan gene symbol?: sasD
  • synonym:
  • product: cell wall surface anchor family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0136 [new locus tag: SAUSA300_RS00710 ]
  • symbol: SAUSA300_0136
  • product: cell wall surface anchor family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 155169..155894
  • length: 726
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAAAATTAGCAACAGTAGGTTCTTTAATTGTAACAAGCACTTTAGTATTCTCAAGT
    ATGCCTTTTCAAAATGCGCATGCCGACACAACTTCAATGAATGTGTCGAATAAACAAAGC
    CAAAATGTACAAAATCATCGTCCTTATGGCGGAGTAGTACCACAAGGAATGACGCAAGCA
    CAATATACTGAATTAGAGAAAGCTTTACCCCAATTAAGCGCTGGCAGTAATATGCAAGAC
    TATAATATGAAATTGTATGATGCGACGCAAAATATTGCTGATAAATACAATGTGATAATT
    ACAACTAATGTAGGGGTATTTAAACCACATGCTGTTAGAGATATGAATGGCCATGCGTTA
    CCTTTAACAAAAGATGGCAATTTTTATCAAACGAATGTAGATGCAAATGGTGTTAATCAT
    GGTGGTAGTGAAATGGTGCAAAATAAAACAGGTCATATGAGTCAACAAGGCCATATGAAT
    CAGAACACACACATGAACCAACAGCCACACATGCAACAAGGTCATATGCAATCATCAAAC
    CATCAAATGATGAGTCCAAAAGCAAATATGCATTCATCAAATCATCAAATGAACCAAAGT
    AACAAAAAAGTTTTACCAGCTGCTGGTGAAAGTATGACATCAAGTATTCTTACTGCAAGT
    ATTGCCGCACTACTATTAGTATCTGGGTTATTCTTAGCATTTAGACGACGTTCAACAAAT
    AAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    726

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0136 [new locus tag: SAUSA300_RS00710 ]
  • symbol: SAUSA300_0136
  • description: cell wall surface anchor family protein
  • length: 241
  • theoretical pI: 10.2058
  • theoretical MW: 26456.7
  • GRAVY: -0.588382

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 20.7)
  • TheSEED:  
    Virulence, Disease and Defense Adhesion Adhesins in Staphylococcus  Predicted cell-wall-anchored protein SasD (LPXAG motif)
  • PFAM:
    no clan defined Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 28)
    and 2 more
    FAM220; FAM220 family (PF15487; HMM-score: 11.3)
    TFIIA; Transcription factor IIA, alpha/beta subunit (PF03153; HMM-score: 7.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 10
    • Extracellular Score: 0
    • Internal Helices: 2
  • LocateP: LPxTG Cell-wall anchored
    • Prediction by SwissProt Classification: Cell Wall
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: found LPxTG motif :LPAAG
  • SignalP: Signal peptide SP(Sec/SPI) length 28 aa
    • SP(Sec/SPI): 0.99632
    • TAT(Tat/SPI): 0.002144
    • LIPO(Sec/SPII): 0.000905
    • Cleavage Site: CS pos: 28-29. AHA-DT. Pr: 0.9922
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVSNKQSQNVQNHRPYGGVVPQGMTQAQYTELEKALPQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNVGVFKPHAVRDMNGHALPLTKDGNFYQTNVDANGVNHGGSEMVQNKTGHMSQQGHMNQNTHMNQQPHMQQGHMQSSNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIAALLLVSGLFLAFRRRSTNK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SAUSA300_0136 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]