From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0713 [new locus tag: SAUSA300_RS03830 ]
  • pan locus tag?: SAUPAN002626000
  • symbol: folE
  • pan gene symbol?: queF
  • synonym:
  • product: 7-cyano-7-deazaguanine reductase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0713 [new locus tag: SAUSA300_RS03830 ]
  • symbol: folE
  • product: 7-cyano-7-deazaguanine reductase
  • replicon: chromosome
  • strand: -
  • coordinates: 791586..792086
  • length: 501
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCACATGGCCGTCAACAAGATGAATTACAAGATATAACTTTATTAGGAAATCAAGAC
    AATACTTACAATTTTGACTATCGTCCTGATGTATTAGAATCGTTTGATAATAAGCATCAA
    GGTCGTGACTATTTCGTAAAATTCAACTGTCCAGAATTTACATCATTATGTCCAATTACT
    GGGCAACCAGATTTTGCAACTATCTATATTTCATATATTCCAAATGTTAAAATGGTTGAA
    TCAAAATCTTTGAAATTATACTTATTTAGTTTCAGAAATCACGGTGATTTTCACGAAGAT
    TGTATGAATATTATTATGAATGATTTGATAGAGCTTATGGACCCACATTATATTGAAGTC
    TGGGGCAAGTTCACACCACGTGGTGGAATTTCTATTGATCCTTATACAAACTATGGACGT
    CCAAATTCTAAATATGAAAAAATGGCTGAGCATCGTTTGATGAATCATGATTTATATCCC
    GAAAAAATAGATAATCGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0713 [new locus tag: SAUSA300_RS03830 ]
  • symbol: FolE
  • description: 7-cyano-7-deazaguanine reductase
  • length: 166
  • theoretical pI: 5.23642
  • theoretical MW: 19645
  • GRAVY: -0.715663

Function[edit | edit source]

  • reaction:
    EC 1.7.1.13?  ExPASy
    PreQ1 synthase 7-aminomethyl-7-carbaguanine + 2 NADP+ = 7-cyano-7-carbaguanine + 2 NADPH
    EC 3.5.4.16?  ExPASy
    GTP cyclohydrolase I GTP + H2O = formate + 2-amino-4-hydroxy-6-(erythro-1,2,3-trihydroxypropyl)-dihydropteridine triphosphate
  • TIGRFAM:
    7-cyano-7-deazaguanine reductase (TIGR03139; EC 1.7.1.13; HMM-score: 177.6)
    and 1 more
    Genetic information processing Transcription RNA processing queuine synthase (TIGR03138; EC 1.7.1.13; HMM-score: 82.1)
  • TheSEED:  
    RNA Metabolism RNA processing and modification Queuosine-Archaeosine Biosynthesis  NADPH dependent preQ0 reductase (EC 1.7.1.13)
    and 2 more
    Queuosine exploration RZ  NADPH dependent preQ0 reductase (EC 1.7.1.13)
    Test Q  NADPH dependent preQ0 reductase (EC 1.7.1.13)
  • PFAM:
    THBO-biosyn (CL0334) QueF; QueF-like protein (PF14489; HMM-score: 120.4)
    and 1 more
    QueF_N; Nitrile reductase, 7-cyano-7-deazaguanine-reductase N-term (PF14819; HMM-score: 23.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014371
    • TAT(Tat/SPI): 0.007821
    • LIPO(Sec/SPII): 0.002881
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAHGRQQDELQDITLLGNQDNTYNFDYRPDVLESFDNKHQGRDYFVKFNCPEFTSLCPITGQPDFATIYISYIPNVKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPHYIEVWGKFTPRGGISIDPYTNYGRPNSKYEKMAEHRLMNHDLYPEKIDNR

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: LexA (repression) regulon
    LexA(TF)important in SOS response; RegPrecise    transcription unit transferred from N315 data RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]