Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0875 [new locus tag: SAUSA300_RS04720 ]
- pan locus tag?: SAUPAN003109000
- symbol: SAUSA300_0875
- pan gene symbol?: sufT
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0875 [new locus tag: SAUSA300_RS04720 ]
- symbol: SAUSA300_0875
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 959943..960209
- length: 267
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914652 NCBI
- RefSeq: YP_493575 NCBI
- BioCyc: see SAUSA300_RS04720
- MicrobesOnline: 1292390 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGTAATTGACCCTGAATTAGGAATTGATATCGTTAATTTGGGTTTAGTATACAAAGTG
AATGTTGATGATGAAGGCGTATGTACAGTTGATATGACTTTAACATCAATGGGATGTCCA
ATGGGACCTCAAATTATTGATCAAGTTAAAACAGTATTAGCAGAGATTCCTGAAATTCAG
GATACTGAAGTGAATATCGTATGGAGTCCACCTTGGACAAAAGATATGATGTCACGTTAC
GCTAAGATTGCACTTGGTGTGAGCTAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0875 [new locus tag: SAUSA300_RS04720 ]
- symbol: SAUSA300_0875
- description: hypothetical protein
- length: 88
- theoretical pI: 3.82287
- theoretical MW: 9652.24
- GRAVY: 0.285227
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other probable FeS assembly SUF system protein SufT (TIGR03406; HMM-score: 94.7)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system protein (TIGR02945; HMM-score: 93.1)and 1 moreEnergy metabolism Other phenylacetate-CoA oxygenase, PaaJ subunit (TIGR02159; HMM-score: 47.3)
- TheSEED :
- Fe-S protein maturation auxiliary factor SufT
- PFAM: NifU (CL0232) FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 64.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9811
- Cytoplasmic Membrane Score: 0.0089
- Cell wall & surface Score: 0
- Extracellular Score: 0.01
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013851
- TAT(Tat/SPI): 0.000677
- LIPO(Sec/SPII): 0.00459
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGPQIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
One of three iron-sulfur cluster carrier proteins (Nfu, SufA and SufT) that can transfer preformed Fe-S clusters to staphylococcal proteins that require Fe-S clusters to function. Although they are partially functionally-redundant, each has a preferred target enzyme (Nfu is preferred in vivo to generate holo-aconitase while SufT is preferred to generate holo-LipA). By altering the relative amount of each carrier protein, the cell can control which target enzymes receive Fe-S clusters when resources are limited.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Ameya A Mashruwala, Christina A Roberts, Shiven Bhatt, Kerrie L May, Ronan K Carroll, Lindsey N Shaw, Jeffrey M Boyd
Staphylococcus aureus SufT: an essential iron-sulphur cluster assembly factor in cells experiencing a high-demand for lipoic acid.
Mol Microbiol: 2016, 102(6);1099-1119
[PubMed:27671355] [WorldCat.org] [DOI] (I p)