Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0843 [new locus tag: NWMN_RS04750 ]
- pan locus tag?: SAUPAN003109000
- symbol: NWMN_0843
- pan gene symbol?: sufT
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0843 [new locus tag: NWMN_RS04750 ]
- symbol: NWMN_0843
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 936539..936856
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330493 NCBI
- RefSeq: YP_001331877 NCBI
- BioCyc:
- MicrobesOnline: 3706392 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGATATGGATGGAAGAGGCATTGAAAGATAGTATCTTAGGTGCATTAGAAATGGTAATT
GACCCTGAATTAGGAATTGATATCGTTAATTTGGGTTTAGTATACAAAGTGAATGTTGAT
GATGAAGGCGTATGTACAGTTGATATGACTTTAACATCAATGGGATGTCCAATGGGACCT
CAAATTATTGATCAAGTTAAAACAGTATTAGCAGAGATTCCTGAAATTCAGGATACTGAA
GTGAATATCGTATGGAGTCCACCTTGGACAAAAGATATGATGTCACGTTACGCTAAGATT
GCACTTGGTGTGAGCTAA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0843 [new locus tag: NWMN_RS04750 ]
- symbol: NWMN_0843
- description: hypothetical protein
- length: 105
- theoretical pI: 3.77229
- theoretical MW: 11583.5
- GRAVY: 0.313333
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other probable FeS assembly SUF system protein SufT (TIGR03406; HMM-score: 102.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system protein (TIGR02945; HMM-score: 101.6)and 1 moreEnergy metabolism Other phenylacetate-CoA oxygenase, PaaJ subunit (TIGR02159; HMM-score: 46.4)
- TheSEED :
- Fe-S protein maturation auxiliary factor SufT
- PFAM: NifU (CL0232) FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 75)and 1 morePKinase (CL0016) Seadorna_VP7; Seadornavirus VP7 (PF07387; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9897
- Cytoplasmic Membrane Score: 0.0042
- Cell wall & surface Score: 0
- Extracellular Score: 0.006
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010327
- TAT(Tat/SPI): 0.00027
- LIPO(Sec/SPII): 0.000439
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIWMEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGPQIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.