Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000936 [new locus tag: EGJ38_RS04675 ]
- pan locus tag?: SAUPAN003109000
- symbol: sufT
- pan gene symbol?: sufT
- synonym:
- alternate name: JSNZ_000936
- product: metal-sulfur cluster assembly factor
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000936 [new locus tag: EGJ38_RS04675 ]
- symbol: sufT
- product: metal-sulfur cluster assembly factor
- replicon: chromosome
- strand: +
- coordinates: 938334..938642
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422907 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGAAGAGGCATTGAAAGATAGTATCTTAGGTGCATTAGAAATGGTAATTGACCCTGAA
TTAGGAATTGATATCGTTAATTTAGGTTTAGTATACAAAGTGAATGTTGATGATGAAGGC
GTATGTACAGTTGATATGACTTTAACATCAATGGGATGTCCAATGGGACCTCAAATTATT
GATCAAGTTAAAACAGTATTAGCAGAGATTCCTGAAATTCAGGATACTGAAGTGAATATC
GTATGGAGTCCACCTTGGACAAAAGATATGATGTCACGTTACGCTAAGATTGCACTTGGT
GTGAGCTAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000936 [new locus tag: EGJ38_RS04675 ]
- symbol: SufT
- description: metal-sulfur cluster assembly factor
- length: 102
- theoretical pI: 3.77229
- theoretical MW: 11153
- GRAVY: 0.268627
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other probable FeS assembly SUF system protein SufT (TIGR03406; HMM-score: 102.1)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system protein (TIGR02945; HMM-score: 101.7)and 1 moreEnergy metabolism Other phenylacetate-CoA oxygenase, PaaJ subunit (TIGR02159; HMM-score: 46.6)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: NifU (CL0232) FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 75.1)and 1 morePKinase (CL0016) Seadorna_VP7; Seadornavirus VP7 (PF07387; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9843
- Cytoplasmic Membrane Score: 0.0049
- Cell wall & surface Score: 0
- Extracellular Score: 0.0107
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00666
- TAT(Tat/SPI): 0.000209
- LIPO(Sec/SPII): 0.000328
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422907 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGPQIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]