Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0900 [new locus tag: SAUSA300_RS15250 ]
- pan locus tag?: SAUPAN003169000
- symbol: SAUSA300_0900
- pan gene symbol?: —
- synonym:
- product: putative competence protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0900 [new locus tag: SAUSA300_RS15250 ]
- symbol: SAUSA300_0900
- product: putative competence protein
- replicon: chromosome
- strand: +
- coordinates: 988576..988833
- length: 258
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3914538 NCBI
- RefSeq: YP_493600 NCBI
- BioCyc: see SAUSA300_RS15250
- MicrobesOnline: 1292415 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTAGTAGCTTTAAATGAAGAAAAGGAACGCGTATTAGCAACTACTGCATTGAGAAAG
ACACAATATTTTTGTCCGGTGTGTGGCAAGCAAGTTATTTTAAAGCGTGGGCTCAAAGTA
ATTAGTCATTTTGCACATAAACATTTAGCGGAACAAAAATGTTTTAATAATGAAACGATT
AAACATTATAAAAGTAAATTGATTTTAGCACAGATGATACAGCAACAAGGATGTAAAGTA
GAGATAGAGCCATTTTAA60
120
180
240
258
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0900 [new locus tag: SAUSA300_RS15250 ]
- symbol: SAUSA300_0900
- description: putative competence protein
- length: 85
- theoretical pI: 9.94583
- theoretical MW: 9840.67
- GRAVY: -0.210588
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Competence protein CoiA
- PFAM: PDDEXK (CL0236) CoiA; Competence protein CoiA-like family (PF06054; HMM-score: 51.9)and 5 moreZn_Beta_Ribbon (CL0167) HVO_2753_ZBP; Small zinc finger protein HVO_2753-like, Zn-binding pocket (PF07754; HMM-score: 15.8)Zn_ribbon_NOB1; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 15.6)C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 14.7)no clan defined Cys_rich_KTR; Cysteine-rich KTR (PF14205; HMM-score: 13)DUF5795; Family of unknown function (DUF5795) (PF19108; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9934
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0049
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006438
- TAT(Tat/SPI): 0.001641
- LIPO(Sec/SPII): 0.003812
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETIKHYKSKLILAQMIQQQGCKVEIEPF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]