From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS15250 [old locus tag: SAUSA300_0900 ]
  • pan locus tag?: SAUPAN003169000
  • symbol: SAUSA300_RS15250
  • pan gene symbol?: —
  • synonym:
  • product: competence protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS15250 [old locus tag: SAUSA300_0900 ]
  • symbol: SAUSA300_RS15250
  • product: competence protein
  • replicon: chromosome
  • strand: +
  • coordinates: 988576..988833
  • length: 258
  • essential: unknown

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTAGTAGCTTTAAATGAAGAAAAGGAACGCGTATTAGCAACTACTGCATTGAGAAAG
    ACACAATATTTTTGTCCGGTGTGTGGCAAGCAAGTTATTTTAAAGCGTGGGCTCAAAGTA
    ATTAGTCATTTTGCACATAAACATTTAGCGGAACAAAAATGTTTTAATAATGAAACGATT
    AAACATTATAAAAGTAAATTGATTTTAGCACAGATGATACAGCAACAAGGATGTAAAGTA
    GAGATAGAGCCATTTTAA
    60
    120
    180
    240
    258


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS15250 [old locus tag: SAUSA300_0900 ]
  • symbol: SAUSA300_RS15250
  • description: competence protein
  • length: 85
  • theoretical pI: 9.94583
  • theoretical MW: 9840.67
  • GRAVY: -0.210588

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_0900
  • PFAM:
    PDDEXK (CL0236) CoiA; Competence protein CoiA-like family (PF06054; HMM-score: 51.9)
    and 5 more
    Zn_Beta_Ribbon (CL0167) HVO_2753_ZBP; Small zinc finger protein HVO_2753-like, Zn-binding pocket (PF07754; HMM-score: 15.8)
    Zn_ribbon_NOB1; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 15.6)
    C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 14.7)
    no clan defined Cys_rich_KTR; Cysteine-rich KTR (PF14205; HMM-score: 13)
    DUF5795; Family of unknown function (DUF5795) (PF19108; HMM-score: 12.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9934
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0049
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006438
    • TAT(Tat/SPI): 0.001641
    • LIPO(Sec/SPII): 0.003812
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETIKHYKSKLILAQMIQQQGCKVEIEPF

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]