From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS15250 [old locus tag: SAUSA300_0900 ]
  • pan locus tag?: SAUPAN003169000
  • symbol: SAUSA300_RS15250
  • pan gene symbol?:
  • synonym:
  • product: competence protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_RS15250 [old locus tag: SAUSA300_0900 ]
  • symbol: SAUSA300_RS15250
  • product: competence protein
  • replicon: chromosome
  • strand: +
  • coordinates: 988576..988833
  • length: 258
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_007793 (988576..988833) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGTTAGTAGCTTTAAATGAAGAAAAGGAACGCGTATTAGCAACTACTGCATTGAGAAAG
    ACACAATATTTTTGTCCGGTGTGTGGCAAGCAAGTTATTTTAAAGCGTGGGCTCAAAGTA
    ATTAGTCATTTTGCACATAAACATTTAGCGGAACAAAAATGTTTTAATAATGAAACGATT
    AAACATTATAAAAGTAAATTGATTTTAGCACAGATGATACAGCAACAAGGATGTAAAGTA
    GAGATAGAGCCATTTTAA
    60
    120
    180
    240
    258

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_RS15250 [old locus tag: SAUSA300_0900 ]
  • symbol: SAUSA300_RS15250
  • description: competence protein
  • length: 85
  • theoretical pI: 9.94583
  • theoretical MW: 9840.67
  • GRAVY: -0.210588

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    PDDEXK (CL0236) CoiA; Competence protein CoiA-like family (PF06054; HMM-score: 51.7)
    and 3 more
    Zn_Beta_Ribbon (CL0167) NOB1_Zn_bind; Nin one binding (NOB1) Zn-ribbon like (PF08772; HMM-score: 15.7)
    C2H2-zf (CL0361) zf-Di19; Drought induced 19 protein (Di19), zinc-binding (PF05605; HMM-score: 13.7)
    no clan definedCys_rich_KTR; Cysteine-rich KTR (PF14205; HMM-score: 12.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006438
    • TAT(Tat/SPI): 0.001641
    • LIPO(Sec/SPII): 0.003812
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_001548305 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETIKHYKSKLILAQMIQQQGCKVEIEPF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]