From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0963 [new locus tag: SAUSA300_RS05175 ]
  • pan locus tag?: SAUPAN003270000
  • symbol: qoxA
  • pan gene symbol?: qoxA
  • synonym:
  • product: quinol oxidase, subunit II

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0963 [new locus tag: SAUSA300_RS05175 ]
  • symbol: qoxA
  • product: quinol oxidase, subunit II
  • replicon: chromosome
  • strand: -
  • coordinates: 1055592..1056692
  • length: 1101
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    GTGTCAAAATTTAAGTCTTTGCTTCTATTATTTGGCACACTAATTTTACTTAGTGGTTGT
    TCAAATATAGAAATTTTCAACGCAAAAGGGCCAGTAGCAAGTAGTCAGAAGTTCTTGATT
    CTTTATTCAATCGTCTTCATGCTTGTTATTTGTTTCGTTGTACTTGGCATGTTCGCCATT
    TTTATTTACAAGTATAGTTATAATAAGAATGCCGAATCTGGTAAGATGCACCATAATGCC
    ATCATTGAAACAATATGGTTTGTAATACCTATCATAATCGTTGCTGCTTTAGCTATTCCT
    ACAGTTAAAACTTTATACGATTACGAAAAACCACCGAAGAGTGAGAAAGATCCAATGGTT
    GTATATGCAGTAAGTGCAGGATACAAATGGTTCTTTGCTTATCCAGATGAACATATAGAG
    ACTGTTAATACATTAACAATCCCTAAAGATCGTCCTGTTGTATTTAAGCTTCAAGCTATG
    GATACAATGACAAGTTTCTGGATTCCACAATTAGGTGGTCAAAAATATGCCATGACTGGC
    ATGACAATGAATTGGACGTTAGAAGCATCTCAAACTGGTACGTTCAGAGGTCGTAACTCT
    AACTTCAATGGTGAAGGATTCTCACGTCAAACATTTAAAGTAAATGCCGTTAGTCAAAAA
    GACTACGACAAATGGGTGAAAGAAGTTAAAGGTAAGAAAACGTTAGATCAAGATACATTT
    GATAAACAATTATTACCAAGCACACCTAATAAAGCTTTAGAATTTAATGGTACACATATG
    GCGTTTGTTGATCCAGCAGCCGATCCAGAATACATCTTCTATGCATATAAACGTTTCAAT
    TTCGAATTAAAAGATCCAAACTTCACTAGTGAAGAAAATATGTTTAAAGATGTATCAGAC
    AAACCATTAATACCTGCTCGTAAAGCTCAAATTACAAATGCGAACTATAAACGACATGGT
    ATGAAGTTGATGATTCTTGGAAATGACGAACCATATAACAATGAGTTCAAGAAAGATGAA
    TCGAAAAATGCGAAAGAAATGAAGAAAATTTCAAAAGATGCGCAAGATCAAGACAATGAT
    GATCATGGAGGTGGACATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1101

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0963 [new locus tag: SAUSA300_RS05175 ]
  • symbol: QoxA
  • description: quinol oxidase, subunit II
  • length: 366
  • theoretical pI: 9.00291
  • theoretical MW: 41776.8
  • GRAVY: -0.337158

Function[edit | edit source]

  • reaction:
    EC 1.9.3.-?  ExPASy
    EC 1.10.3.-?  ExPASy
    2 a quinol + O2 = 2 a quinone + 2 H2O?
  • TIGRFAM:
    Metabolism Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit II (TIGR01432; EC 1.10.3.-; HMM-score: 430.2)
    and 2 more
    Metabolism Energy metabolism Electron transport ubiquinol oxidase, subunit II (TIGR01433; EC 1.10.3.-; HMM-score: 181.3)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 135.6)
  • TheSEED:  
    Respiration Electron accepting reactions Terminal cytochrome C oxidases  quinol oxidase polypeptide II QoxA (EC:1.9.3.-)
  • PFAM:
    no clan defined COX2_TM; Cytochrome C oxidase subunit II, transmembrane domain (PF02790; HMM-score: 44.7)
    and 9 more
    CU_oxidase (CL0026) COX2; Cytochrome C oxidase subunit II, periplasmic domain (PF00116; HMM-score: 23.8)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 17.8)
    CU_oxidase (CL0026) Cupredoxin_1; Cupredoxin-like domain (PF13473; HMM-score: 13.4)
    no clan defined Bac_export_2; FlhB HrpN YscU SpaS Family (PF01312; HMM-score: 12.3)
    HRG; Haem-transporter, endosomal/lysosomal, haem-responsive gene (PF16954; HMM-score: 11.3)
    Bunya_G2; Bunyavirus glycoprotein G2 (PF03563; HMM-score: 9.9)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.7)
    BPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 7.8)
    no clan defined RELT; Tumour necrosis factor receptor superfamily member 19 (PF12606; HMM-score: 7.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane(Lipid modified N-termini)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILLSGCS
  • SignalP: Signal peptide LIPO(Sec/SPII) length 19 aa
    • SP(Sec/SPI): 0.000508
    • TAT(Tat/SPI): 0.000057
    • LIPO(Sec/SPII): 0.998769
    • Cleavage Site: CS pos: 19-20. LSG-CS. Pr: 0.9995
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSKFKSLLLLFGTLILLSGCSNIEIFNAKGPVASSQKFLILYSIVFMLVICFVVLGMFAIFIYKYSYNKNAESGKMHHNAIIETIWFVIPIIIVAALAIPTVKTLYDYEKPPKSEKDPMVVYAVSAGYKWFFAYPDEHIETVNTLTIPKDRPVVFKLQAMDTMTSFWIPQLGGQKYAMTGMTMNWTLEASQTGTFRGRNSNFNGEGFSRQTFKVNAVSQKDYDKWVKEVKGKKTLDQDTFDKQLLPSTPNKALEFNGTHMAFVDPAADPEYIFYAYKRFNFELKDPNFTSEENMFKDVSDKPLIPARKAQITNANYKRHGMKLMILGNDEPYNNEFKKDESKNAKEMKKISKDAQDQDNDDHGGGH

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]