Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1212 [new locus tag: SAUSA300_RS06575 ]
- pan locus tag?: SAUPAN003672000
- symbol: SAUSA300_1212
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1212 [new locus tag: SAUSA300_RS06575 ]
- symbol: SAUSA300_1212
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1331291..1331632
- length: 342
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914118 NCBI
- RefSeq: YP_493909 NCBI
- BioCyc: see SAUSA300_RS06575
- MicrobesOnline: 1292727 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATAAGTAATGGTAAAATGACGATGAAATTGAATAATGTTAAGCAAAAGCGTCATATT
TTATGCACAAATGAATATAATAATAAGAAAAATAATTCATCTTTATTACCAAGTTATACT
ATAATAGATTCTAATGAAAGTGAAAAGATGACTAAAAAAGAATTTATTGATATTCCAGTT
TTGTTTGATGATGAAGGGAATTTTAGAATAAAACAAGTTATAGATTATAAAAAGATAATA
GGTAAATCTTATGTGAATGGTAAATATATTGAAACGAAATTAGGTAAGGTTCATTATTCT
AAAACTGGTTTTCATGTAGTTCCGTATATTAAAAAGGAGTGA60
120
180
240
300
342
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1212 [new locus tag: SAUSA300_RS06575 ]
- symbol: SAUSA300_1212
- description: hypothetical protein
- length: 113
- theoretical pI: 10.1372
- theoretical MW: 13194.3
- GRAVY: -0.704425
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107845: hypothetical protein
- PFAM: no clan defined Ntox50; Bacterial toxin 50 (PF15542; HMM-score: 101.3)and 1 morePhosphatase (CL0031) DSPn; Dual specificity protein phosphatase, N-terminal half (PF14671; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3819
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0.0033
- Extracellular Score: 0.6136
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009194
- TAT(Tat/SPI): 0.000311
- LIPO(Sec/SPII): 0.001256
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MISNGKMTMKLNNVKQKRHILCTNEYNNKKNNSSLLPSYTIIDSNESEKMTKKEFIDIPVLFDDEGNFRIKQVIDYKKIIGKSYVNGKYIETKLGKVHYSKTGFHVVPYIKKE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]