Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1400 [new locus tag: SAUSA300_RS07640 ]
- pan locus tag?: SAUPAN001830000
- symbol: SAUSA300_1400
- pan gene symbol?: —
- synonym:
- product: phiSLT ORF92-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1400 [new locus tag: SAUSA300_RS07640 ]
- symbol: SAUSA300_1400
- product: phiSLT ORF92-like protein
- replicon: chromosome
- strand: -
- coordinates: 1566552..1566830
- length: 279
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3915257 NCBI
- RefSeq: YP_494097 NCBI
- BioCyc: see SAUSA300_RS07640
- MicrobesOnline: 1292915 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTTTAGAAGAAATTAAATTGTGGTTGAGAATTGACTATAATTTCGAAAATGATTTA
ATTGAAGGTCTCATTCAATCGGCTAAGTCTGAATTACTATTAAGTGGGGTTCCAGATTAT
GACAAAGATGACTTGGAATACCCGCTTTTTTGTACAGCGATTAAATATATCATTGCAAGA
GATTATGAAAGTCGTGGATACTCAAATGACCAATCTAGAAGCAAGGTGTTTAATGAAAAA
GGATTGCAAAAAATGATTTTGAAATTAAAAAAGTGGTAG60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1400 [new locus tag: SAUSA300_RS07640 ]
- symbol: SAUSA300_1400
- description: phiSLT ORF92-like protein
- length: 92
- theoretical pI: 4.86652
- theoretical MW: 10885.4
- GRAVY: -0.490217
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions uncharacterized phage protein (possible DNA packaging) (TIGR01560; HMM-score: 48)and 2 moreribose 5-phosphate isomerase (TIGR02133; EC 5.3.1.6; HMM-score: 15.6)Mobile and extrachromosomal element functions Prophage functions phage conserved hypothetical protein, phiE125 gp8 family (TIGR02215; HMM-score: 13.3)
- TheSEED :
- Phage DNA packaging protein
- PFAM: YqbG (CL0643) Phage_connect_1; Phage gp6-like head-tail connector protein (PF05135; HMM-score: 50.5)and 1 morePhage_connect_2; Phage connector protein (PF24829; HMM-score: 14.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8027
- Cytoplasmic Membrane Score: 0.0023
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.195
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002928
- TAT(Tat/SPI): 0.000183
- LIPO(Sec/SPII): 0.000244
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLEEIKLWLRIDYNFENDLIEGLIQSAKSELLLSGVPDYDKDDLEYPLFCTAIKYIIARDYESRGYSNDQSRSKVFNEKGLQKMILKLKKW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]